(data stored in ACNUC13479 zone)

EMBL: CP002688.PE59

CP002688.PE59        Location/Qualifiers
FT   CDS             125304..125819
FT                   /codon_start=1
FT                   /locus_tag="AT5G01305"
FT                   /product="transcription factor bHLH140-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01305"
FT                   /db_xref="GOA:A0A178UDM7"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178UDM7"
FT                   /protein_id="ANM69513.1"
FT                   /translation="MDDFNLRSENPNSSSTTSSSSSSFHRHKSETGNTKRSRSTSTLST
FT                   DPQSVAARDRRHRISDRFKILQSMVPGGAKMDTVSMLDEAISYVKFLKAQIWYHQNMLL
FT                   FINDHETTSSCTYSPGAGEFGPKLFGYDDDYAPIMDTYSQGVPLTVADSKYTPWFGSVD
FT                   DEQERDSS"
     MDDFNLRSEN PNSSSTTSSS SSSFHRHKSE TGNTKRSRST STLSTDPQSV AARDRRHRIS        60
     DRFKILQSMV PGGAKMDTVS MLDEAISYVK FLKAQIWYHQ NMLLFINDHE TTSSCTYSPG       120
     AGEFGPKLFG YDDDYAPIMD TYSQGVPLTV ADSKYTPWFG SVDDEQERDS S                171
//

If you have problems or comments...

PBIL Back to PBIL home page