(data stored in ACNUC13479 zone)

EMBL: CP002688.PE6

CP002688.PE6         Location/Qualifiers
FT   CDS             complement(join(5335..5576,5697..5769))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01015"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT1G65295.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01015.1"
FT                   /db_xref="GOA:Q8LBK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LBK1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR279885.1,INSD:DR279889.1,INSD:DR279890.1,
FT                   INSD:DR279892.1,INSD:EL185242.1,INSD:EH915082.1,
FT                   INSD:EH906100.1,INSD:EL138832.1,INSD:EL061886.1,
FT                   INSD:EH806402.1,INSD:DR374946.1,INSD:DR279886.1,
FT                   INSD:DR279891.1,INSD:DR279884.1,INSD:DR279881.1,
FT                   INSD:DR279883.1,INSD:EL041638.1,INSD:DR279887.1,
FT                   INSD:DR279888.1,INSD:DR279882.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024551.1,INSD:BX833982.1,INSD:BX833637.1,
FT                   INSD:AY087164.1"
FT                   /protein_id="AED90286.1"
FT                   /translation="MESSLHSVIFLGLLATILVTTNGQGDGTGLNAEEMWPVEVGMEYR
FT                   VWRRKLMTPLELCLECKCCSSTTCATMPCCFGINCQLPNKPFGVCAFVPKSCHCNSCSI
FT                   "
     MESSLHSVIF LGLLATILVT TNGQGDGTGL NAEEMWPVEV GMEYRVWRRK LMTPLELCLE        60
     CKCCSSTTCA TMPCCFGINC QLPNKPFGVC AFVPKSCHCN SCSI                        104
//

If you have problems or comments...

PBIL Back to PBIL home page