(data stored in ACNUC13479 zone)

EMBL: CP002688.PE61

CP002688.PE61        Location/Qualifiers
FT   CDS             complement(join(129484..129654,129722..130028,
FT                   130129..130779,130857..131020,131107..131625))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.30"
FT                   /gene_synonym="T10O8_30"
FT                   /locus_tag="AT5G01320"
FT                   /product="Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein"
FT                   /note="Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein; FUNCTIONS IN: in 6 functions;
FT                   LOCATED IN: cellular_component unknown; CONTAINS InterPro
FT                   DOMAIN/s: TPP-binding enzyme, conserved site
FT                   (InterPro:IPR000399), Thiamine pyrophosphate enzyme,
FT                   central domain (InterPro:IPR012000), Pyruvate
FT                   decarboxylase/indolepyruvate decarboxylase
FT                   (InterPro:IPR012110), Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP-binding domain (InterPro:IPR012001),
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP-binding
FT                   (InterPro:IPR011766); BEST Arabidopsis thaliana protein
FT                   match is: Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein (TAIR:AT4G33070.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M040"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M040"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU236252.1,INSD:AU227094.1,INSD:BP575331.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT004248.1"
FT                   /protein_id="AED90327.1"
FT                   /translation="MDTKIGAIDTCKPTTGDIGSPPSNAVATIQDSAPITTTSESTLGR
FT                   HLSRRLVQAGVTDVFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGV
FT                   GACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQEL
FT                   RCFQTVTCYQAVVNNLEDAHEQIDKAIATALKESKPVYISISCNLAATPHPTFARDPVP
FT                   FDLTPRMSNTMGLEAAVEATLEFLNKAVKPVMVGGPKLRVAKASEAFLELADASGYPLA
FT                   VMPSTKGLVPENHPHFIGTYWGAVSTPFCSEIVESADAYIFAGPIFNDYSSVGYSLLLK
FT                   KEKAIIVHPDRVVVANGPTFGCVLMSDFFRELAKRVKRNETAYENYERIFVPEGKPLKC
FT                   KPGEPLRVNAMFQHIQKMLSSETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWS
FT                   VGATLGYAQATPEKRVLSFIGDGSFQVTAQDISTMIRNGQKAIIFLINNGGYTIEVEIH
FT                   DGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTATTEKKDSLCFIEVIV
FT                   HKDDTSKELLEWGSRVSAANGRPPNPQ"
     MDTKIGAIDT CKPTTGDIGS PPSNAVATIQ DSAPITTTSE STLGRHLSRR LVQAGVTDVF        60
     SVPGDFNLTL LDHLIAEPEL NNIGCCNELN AGYAADGYAR SRGVGACVVT FTVGGLSVLN       120
     AIAGAYSENL PVICIVGGPN SNDFGTNRIL HHTIGLPDFS QELRCFQTVT CYQAVVNNLE       180
     DAHEQIDKAI ATALKESKPV YISISCNLAA TPHPTFARDP VPFDLTPRMS NTMGLEAAVE       240
     ATLEFLNKAV KPVMVGGPKL RVAKASEAFL ELADASGYPL AVMPSTKGLV PENHPHFIGT       300
     YWGAVSTPFC SEIVESADAY IFAGPIFNDY SSVGYSLLLK KEKAIIVHPD RVVVANGPTF       360
     GCVLMSDFFR ELAKRVKRNE TAYENYERIF VPEGKPLKCK PGEPLRVNAM FQHIQKMLSS       420
     ETAVIAETGD SWFNCQKLKL PKGCGYEFQM QYGSIGWSVG ATLGYAQATP EKRVLSFIGD       480
     GSFQVTAQDI STMIRNGQKA IIFLINNGGY TIEVEIHDGP YNVIKNWNYT GLVDAIHNGE       540
     GKCWTTKVRY EEELVEAIKT ATTEKKDSLC FIEVIVHKDD TSKELLEWGS RVSAANGRPP       600
     NPQ                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page