(data stored in ACNUC13479 zone)

EMBL: CP002688.PE66

CP002688.PE66        Location/Qualifiers
FT   CDS             complement(join(147608..147941,148018..148376,
FT                   148502..148673,148764..149035))
FT                   /codon_start=1
FT                   /gene="TBL3"
FT                   /gene_synonym="T10O8.70"
FT                   /gene_synonym="T10O8_70"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 3"
FT                   /locus_tag="AT5G01360"
FT                   /product="trichome birefringence-like protein (DUF828)"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 3 (TBL3); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF231,
FT                   plant (InterPro:IPR004253); BEST Arabidopsis thaliana
FT                   protein match is: Plant protein of unknown function
FT                   (DUF828) (TAIR:AT3G55990.1); Has 1290 Blast hits to 1278
FT                   proteins in 29 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   3; Fungi - 2; Plants - 1285; Viruses - 0; Other Eukaryotes
FT                   - 0 (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE45"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235894.1,INSD:DR249278.1,INSD:BP797316.1"
FT                   /protein_id="AED90332.2"
FT                   /translation="MKFPCFSLLPEEKIRKERSEILEVLDDRFEFDPEECNVAAGKWVY
FT                   NSSIEPLYTDRSCPYIDRQFSCMKNGQPETDYLRWEWQPDDCTIPRFSPKLAMNKLRGK
FT                   RLLFVGDSLQRSQWESFVCLVESIIPEGEKSMKRSQKYFVFKAKEYNATIEFYWAPYIV
FT                   ESNTDIPVISDPKKRIVKVDSVKDRAKFWEGADILVFNTYVWWMSGLRMKALWGSFGNG
FT                   ESGAEALDTQVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWGKPNGTKCF
FT                   NETKPIKDKKFWGTGSNKQMMKVVSSVIKHMTTHVTVINITQLSEYRIDAHTSVYTETG
FT                   GKILTAEQRADPMHHADCIHWCLPGLPDTWNRILLAHL"
     MKFPCFSLLP EEKIRKERSE ILEVLDDRFE FDPEECNVAA GKWVYNSSIE PLYTDRSCPY        60
     IDRQFSCMKN GQPETDYLRW EWQPDDCTIP RFSPKLAMNK LRGKRLLFVG DSLQRSQWES       120
     FVCLVESIIP EGEKSMKRSQ KYFVFKAKEY NATIEFYWAP YIVESNTDIP VISDPKKRIV       180
     KVDSVKDRAK FWEGADILVF NTYVWWMSGL RMKALWGSFG NGESGAEALD TQVAYRLGLK       240
     TWANWVDSTV DPNKTRVFFT TMSPTHTRSA DWGKPNGTKC FNETKPIKDK KFWGTGSNKQ       300
     MMKVVSSVIK HMTTHVTVIN ITQLSEYRID AHTSVYTETG GKILTAEQRA DPMHHADCIH       360
     WCLPGLPDTW NRILLAHL                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page