(data stored in ACNUC13479 zone)

EMBL: CP002688.PE68

CP002688.PE68        Location/Qualifiers
FT   CDS             complement(join(155784..156419,157116..157451))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.90"
FT                   /gene_synonym="T10O8_90"
FT                   /locus_tag="AT5G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="Homeodomain-like superfamily protein; CONTAINS
FT                   InterPro DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   MYB-like (InterPro:IPR017877); BEST Arabidopsis thaliana
FT                   protein match is: Homeodomain-like superfamily protein
FT                   (TAIR:AT2G38250.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01380"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV554251.1,INSD:DR369042.1,INSD:EG461216.1,
FT                   INSD:CB254283.1,INSD:AV545513.1,INSD:CB254566.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028926.1,INSD:AY271677.1"
FT                   /protein_id="AED90334.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
     MDRRNPFQHH HHHHQLHHHL IQQQQLPPPP LSTTATMDPG GGGGGGERIP QWSIEETKEL        60
     LAIREELDQT FMETKRNKLL WEVVAAKMAD KGFVRSAEQC KSKWKNLVTR YKACETTEPD       120
     AIRQQFPFYN EIQSIFEARM QRMLWSEATE PSTSSKRKHH QFSSDDEEEE VDEPNQDINE       180
     ELLSLVETQK RETEVITTST STNPRKRAKK GKGVASGTKA ETAGNTLKDI LEEFMRQTVK       240
     MEKEWRDAWE MKEIEREKRE KEWRRRMAEL EEERAATERR WMEREEERRL REEARAQKRD       300
     SLIDALLNRL NRDHNDDHHN QGF                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page