(data stored in ACNUC13479 zone)

EMBL: CP002688.PE69

CP002688.PE69        Location/Qualifiers
FT   CDS             complement(join(160500..160735,160853..160938,
FT                   161720..161949,162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ,
FT                   conserved site (InterPro:IPR018253); BEST Arabidopsis
FT                   thaliana protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 27199 Blast hits to 26228 proteins
FT                   in 3366 species: Archae - 181; Bacteria - 10265; Metazoa -
FT                   4962; Fungi - 2544; Plants - 3099; Viruses - 15; Other
FT                   Eukaryotes - 6133 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01390"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01390.3"
FT                   /db_xref="GOA:F4K9C8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9C8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285421.1,INSD:EL232018.1,INSD:EH852437.1,
FT                   INSD:AU231248.1,INSD:BP860877.1,INSD:BP852792.1,
FT                   INSD:EL151690.1,INSD:EH967560.1,INSD:DR285420.1,
FT                   INSD:ES069071.1,INSD:EH848080.1,INSD:EL333624.1,
FT                   INSD:AV562937.1,INSD:EH912646.1,INSD:EH849612.1"
FT                   /protein_id="AED90337.1"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRRPTPVEEILTIEIKPGWKKGTKITFLEKVDA
FT                   LTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPS
FT                   KLTTEQKSGIKRMLSP"
     MGVDFYKVLE VDRSANDDEL KKAYRKLAMK WHPDKNPNNK KEAEAKFKQI SEAYDVLSDP        60
     QKRAIYEQYG EEGLNQAPPP GAGGGYPGGS DAGASFRFNP RSADDIFSEF FGFTRPSFGT       120
     GSDSRAGPSG FRRPTPVEEI LTIEIKPGWK KGTKITFLEK VDALTGYTAQ VTTLDGRTLT       180
     VPVNNVISPS YEEVVKGEGM PIPKDPSRKG NLRIRFIIKF PSKLTTEQKS GIKRMLSP         238
//

If you have problems or comments...

PBIL Back to PBIL home page