(data stored in ACNUC13479 zone)

EMBL: CP002688.PE7

CP002688.PE7         Location/Qualifiers
FT   CDS             5339..5593
FT                   /codon_start=1
FT                   /locus_tag="AT5G01017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAW4"
FT                   /protein_id="ANM68741.1"
FT                   /translation="MEQELQWHDLGTKAQTPNGLLGSWQLMPKQQGMVAQVVEEQHLHS
FT                   KHSSNGVISFLLHTLYSIPTSTGHISSAFSPVPSPTHNT"
     MEQELQWHDL GTKAQTPNGL LGSWQLMPKQ QGMVAQVVEE QHLHSKHSSN GVISFLLHTL        60
     YSIPTSTGHI SSAFSPVPSP THNT                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page