(data stored in ACNUC13479 zone)

EMBL: CP002688.PE71

CP002688.PE71        Location/Qualifiers
FT   CDS             complement(join(160500..160938,161546..161949,
FT                   162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ
FT                   (InterPro:IPR003095), Heat shock protein DnaJ, conserved
FT                   site (InterPro:IPR018253); BEST Arabidopsis thaliana
FT                   protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M034"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M034"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP860877.1,INSD:BP852792.1,INSD:EH967560.1,
FT                   INSD:DR285423.1,INSD:DR285420.1,INSD:ES142308.1,
FT                   INSD:ES213088.1,INSD:AV562937.1,INSD:EH912646.1,
FT                   INSD:DR285421.1,INSD:EL232018.1,INSD:DR379770.1,
FT                   INSD:DR285422.1,INSD:EH852437.1,INSD:ES113248.1,
FT                   INSD:AU231248.1,INSD:EL151690.1,INSD:N95992.1,
FT                   INSD:ES205994.1,INSD:EL333624.1,INSD:EH848080.1,
FT                   INSD:ES038958.1,INSD:BP662376.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY084667.1,INSD:BT005582.1,INSD:BX831653.1,
FT                   INSD:AK119010.1"
FT                   /protein_id="AED90335.1"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQ
FT                   LPCSLEDLYKGVSKKMKISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEH
FT                   RGVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVN
FT                   NVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSP"
     MGVDFYKVLE VDRSANDDEL KKAYRKLAMK WHPDKNPNNK KEAEAKFKQI SEAYDVLSDP        60
     QKRAIYEQYG EEGLNQAPPP GAGGGYPGGS DAGASFRFNP RSADDIFSEF FGFTRPSFGT       120
     GSDSRAGPSG FRYGDDIFAS FRAATTGGEA SIPSRKSAPI ERQLPCSLED LYKGVSKKMK       180
     ISRDVLDSSG RPTPVEEILT IEIKPGWKKG TKITFLEKGN EHRGVIPSDL VFIVDEKPHP       240
     VFKRDGNDLV VMQKISLVDA LTGYTAQVTT LDGRTLTVPV NNVISPSYEE VVKGEGMPIP       300
     KDPSRKGNLR IRFIIKFPSK LTTEQKSGIK RMLSP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page