(data stored in ACNUC13479 zone)

EMBL: CP002688.PE72

CP002688.PE72        Location/Qualifiers
FT   CDS             complement(join(161413..161949,162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ
FT                   (InterPro:IPR003095), Heat shock protein DnaJ, conserved
FT                   site (InterPro:IPR018253); BEST Arabidopsis thaliana
FT                   protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 26610 Blast hits to 26386 proteins
FT                   in 3381 species: Archae - 182; Bacteria - 10306; Metazoa -
FT                   4695; Fungi - 2459; Plants - 2906; Viruses - 15; Other
FT                   Eukaryotes - 6047 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01390"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01390.4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285421.1,INSD:EL232018.1,INSD:DR285422.1,
FT                   INSD:EH852437.1,INSD:ES113248.1,INSD:AU231248.1,
FT                   INSD:BP860877.1,INSD:BP852792.1,INSD:EL151690.1,
FT                   INSD:EH967560.1,INSD:DR285423.1,INSD:DR285420.1,
FT                   INSD:ES069071.1,INSD:EH848080.1,INSD:EL333624.1,
FT                   INSD:AV562937.1,INSD:ES038958.1,INSD:EH912646.1"
FT                   /protein_id="AED90338.2"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQ
FT                   LPCSLEDLYKGVSKKMKISRDVLDSSGFVFPLMITHLAFSRGIYLLLLANFFLEQFKLS
FT                   FCGVWFQMFSL"
     MGVDFYKVLE VDRSANDDEL KKAYRKLAMK WHPDKNPNNK KEAEAKFKQI SEAYDVLSDP        60
     QKRAIYEQYG EEGLNQAPPP GAGGGYPGGS DAGASFRFNP RSADDIFSEF FGFTRPSFGT       120
     GSDSRAGPSG FRYGDDIFAS FRAATTGGEA SIPSRKSAPI ERQLPCSLED LYKGVSKKMK       180
     ISRDVLDSSG FVFPLMITHL AFSRGIYLLL LANFFLEQFK LSFCGVWFQM FSL              233
//

If you have problems or comments...

PBIL Back to PBIL home page