(data stored in ACNUC13479 zone)

EMBL: CP002688.PE75

CP002688.PE75        Location/Qualifiers
FT   CDS             complement(join(162803..163505,163615..163718,
FT                   163809..163892,163996..164040,164121..164192,
FT                   164295..164375,164517..164612,164685..164759,
FT                   164845..164892,164996..165079,165167..165274,
FT                   165352..165414,165520..165669,165790..165888,
FT                   165970..166017,166265..166507,166582..166698,
FT                   166988..167056,167391..167936,168051..168605,
FT                   168711..168836,169035..169206,169645..169813,
FT                   169924..169969))
FT                   /codon_start=1
FT                   /gene="ESP4"
FT                   /gene_synonym="ENHANCED SILENCING PHENOTYPE 4"
FT                   /gene_synonym="T10O8.110"
FT                   /gene_synonym="T10O8_110"
FT                   /locus_tag="AT5G01400"
FT                   /product="HEAT repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01400"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9H2"
FT                   /protein_id="ANM68244.1"
FT                   /translation="MKFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQK
FT                   LGLLLDQLRHPAAKSLNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVY
FT                   AAATNLALKTVFLSCLKCTHPAAAPWKDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQD
FT                   KDSVEDTKVSVEENPLCASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEE
FT                   STDGLNGNDGVSLPRVASTSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEIL
FT                   ISSISADLLTDVVMANMHNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLS
FT                   LSTAFPPIAALINPHNEDEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTV
FT                   SPQNVHYIGNRESGIPGLESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDV
FT                   IPSMSVDKLEEFSPKAVGTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYK
FT                   QISMSGGSQLRFSLLAHLGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGE
FT                   AEAEQDFFSSTTAASAYESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLES
FT                   FCCPGSGEVEKDLQHGDRVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKA
FT                   IRLVANKLYSLSFITEQIEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMET
FT                   PSEATSSSTSVTEAQRCLSLYFALCTKKHSLFVHVFSIYKNASDPVKQAIHLQIPILVR
FT                   TMGSSSELLKIIADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILF
FT                   PILPFLPRDDVLRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPA
FT                   RDGIPLKQVTDACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPAL
FT                   SDFILEILSRLVSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPAL
FT                   RAPLTAHASQPEIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQ
FT                   QTSQSQQVSVPLSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQ
FT                   SQNSPIDTGRSEMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPI
FT                   GTGQSDMSQTPQVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEK
FT                   SKESSEEEEEEEEEEE"
     MKFVEALILL YTPHEGIEAD FNISILRGGH PVLKIGDLSI EASQKLGLLL DQLRHPAAKS        60
     LNSSTIIVLI NSLSSVAKKR PAYCGRILPV LLSLDPLSFL KGVYAAATNL ALKTVFLSCL       120
     KCTHPAAAPW KDRLTSALKE IEGGGQAAKA KDLFYKTNGS IQDKDSVEDT KVSVEENPLC       180
     ASSDVAESNL SRKRSGSEYN IDLNGDASDG KRARITPSVS EESTDGLNGN DGVSLPRVAS       240
     TSTGPSDSRG VSDSGPAQQL VGLFGTLVSQ GEKAIGSLEI LISSISADLL TDVVMANMHN       300
     IPPNCSSYAD GTDELVMNMC IVGSDAQIKY PPSFVAGVLS LSTAFPPIAA LINPHNEDEE       360
     VYSVHVDQQM FPAEDARTPP GLLATCDTSF PENEESNTVS PQNVHYIGNR ESGIPGLESS       420
     AQHDGSGALV TNVLSSTNVE AASKNQNASF SGKLLVDVIP SMSVDKLEEF SPKAVGTVAS       480
     ASQFVLPKIS APVVDLSDEE KDSLQKLVFL RIVEAYKQIS MSGGSQLRFS LLAHLGVEFP       540
     SELDPWKILQ EHVLSDYLNH EGHELTVRVL YRLYGEAEAE QDFFSSTTAA SAYESFLLTV       600
     AEALRDSFPP SDKSLSKLLG DSPHLPKSVL MLLESFCCPG SGEVEKDLQH GDRVTQGLSA       660
     VWSLILMRPG IRNDCLNIAL QSAVHHLEEI RMKAIRLVAN KLYSLSFITE QIEEFAKDRL       720
     FSVVSDDCDK MDLDLKSPPN KPQHSISGMS METPSEATSS STSVTEAQRC LSLYFALCTK       780
     KHSLFVHVFS IYKNASDPVK QAIHLQIPIL VRTMGSSSEL LKIIADPPSG SDNLLIQVLQ       840
     TLTEGPTPSS ELILTIRKLF DTRIKDVEIL FPILPFLPRD DVLRIFPHMV NLPMEKFQVA       900
     LSRVLQGSSQ SGPVLSPSEA LIAIHSIDPA RDGIPLKQVT DACNTCFAQR QTFTQQVLAG       960
     VLNQLVQQIP LPMLFMRTVL QAIGAFPALS DFILEILSRL VSKQIWKYPK LWVGFLKCTQ      1020
     TTQPQSYKVL LQLPPLQLGN ALTKIPALRA PLTAHASQPE IQSSLPRSTL AVLGLVPDSQ      1080
     GTQTSQVQAN ETQTSQEQQQ QQASEPQQTS QSQQVSVPLS HSQVDHQEPS QVVASQSQSS      1140
     PIGTVQSAMS QSQNSPIDTG RSEMSQSQNS PIDTGRSEMS QSQNSPIDTG RSEMSQSQNS      1200
     PIDTGRSEMS ESQSSPIGQS QSSPIGTGQS DMSQTPQVSD SSAPEPTSHT RTSDPQASSQ      1260
     TLRDDDEKID DTATSENEVT EIEKSKESSE EEEEEEEEEE                            1300
//

If you have problems or comments...

PBIL Back to PBIL home page