(data stored in ACNUC13479 zone)

EMBL: CP002688.PE77

CP002688.PE77        Location/Qualifiers
FT   CDS             complement(172576..173505)
FT                   /codon_start=1
FT                   /gene="RSR4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PYRIDOXINE BIOSYNTHESIS
FT                   1.3"
FT                   /gene_synonym="ATPDX1"
FT                   /gene_synonym="ATPDX1.3"
FT                   /gene_synonym="PDX1"
FT                   /gene_synonym="PDX1.3"
FT                   /gene_synonym="PYRIDOXINE BIOSYNTHESIS 1.3"
FT                   /gene_synonym="REDUCED SUGAR RESPONSE 4"
FT                   /gene_synonym="T10O8.120"
FT                   /gene_synonym="T10O8_120"
FT                   /locus_tag="AT5G01410"
FT                   /product="Aldolase-type TIM barrel family protein"
FT                   /note="REDUCED SUGAR RESPONSE 4 (RSR4); FUNCTIONS IN:
FT                   protein homodimerization activity, protein
FT                   heterodimerization activity; INVOLVED IN: in 12 processes;
FT                   LOCATED IN: cytosol, endomembrane system, plasma membrane;
FT                   EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Vitamin B6
FT                   biosynthesis protein (InterPro:IPR001852),
FT                   Ribulose-phosphate binding barrel (InterPro:IPR011060);
FT                   BEST Arabidopsis thaliana protein match is: pyridoxine
FT                   biosynthesis 1.1 (TAIR:AT2G38230.1); Has 1807 Blast hits to
FT                   1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01410"
FT                   /db_xref="GOA:Q8L940"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:5K2Z"
FT                   /db_xref="PDB:5K3V"
FT                   /db_xref="PDB:5LNR"
FT                   /db_xref="PDB:5LNS"
FT                   /db_xref="PDB:5LNU"
FT                   /db_xref="PDB:5LNV"
FT                   /db_xref="PDB:5LNW"
FT                   /db_xref="PDB:6HX3"
FT                   /db_xref="PDB:6HXG"
FT                   /db_xref="PDB:6HYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L940"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR352127.1,INSD:EH871921.1,INSD:DR352160.1,
FT                   INSD:BP655325.1,INSD:DR352152.1,INSD:DR352111.1,
FT                   INSD:DR352099.1,INSD:DR352078.1,INSD:DR352126.1,
FT                   INSD:EH893878.1,INSD:EH849943.1,INSD:DR352129.1,
FT                   INSD:BP639550.1,INSD:EH922006.1,INSD:DR352121.1,
FT                   INSD:DR352130.1,INSD:BP832517.1,INSD:DR352080.1,
FT                   INSD:AV806200.1,INSD:ES100717.1,INSD:DR352159.1,
FT                   INSD:BP861855.1,INSD:EH901794.1,INSD:EL014450.1,
FT                   INSD:AV441604.1,INSD:DR352100.1,INSD:DR352083.1,
FT                   INSD:BP611672.1,INSD:EH836524.1,INSD:BP605035.1,
FT                   INSD:BP563180.1,INSD:DR352097.1,INSD:AV819953.1,
FT                   INSD:AV799969.1,INSD:AV831641.1,INSD:DR352125.1,
FT                   INSD:DR352164.1,INSD:DR352089.1,INSD:DR352144.1,
FT                   INSD:DR352110.1,INSD:DR352098.1,INSD:DR352137.1,
FT                   INSD:DR352076.1,INSD:AV534608.1,INSD:AV518959.1,
FT                   INSD:EH971941.1,INSD:DR352163.1,INSD:BP582044.1,
FT                   INSD:DR352123.1,INSD:DR352109.1,INSD:DR352128.1,
FT                   INSD:BP777823.1,INSD:DR352145.1,INSD:DR352143.1,
FT                   INSD:BP611368.1,INSD:AV549741.1,INSD:DR246985.1,
FT                   INSD:DR352094.1,INSD:AV537351.1,INSD:EL149964.1,
FT                   INSD:EH878980.1,INSD:DR352139.1,INSD:DR352102.1,
FT                   INSD:DR352077.1,INSD:DR352136.1,INSD:AV551235.1,
FT                   INSD:DR246981.1,INSD:BP593083.1,INSD:AV519278.1,
FT                   INSD:DR352124.1,INSD:BP824791.1,INSD:DR352084.1,
FT                   INSD:AV537724.1,INSD:BP623357.1,INSD:AV518173.1,
FT                   INSD:DR352131.1,INSD:EL330598.1,INSD:DR352134.1,
FT                   INSD:BP596625.1,INSD:BP838585.1,INSD:DR352118.1,
FT                   INSD:EH876328.1,INSD:DR352147.1,INSD:EH873327.1,
FT                   INSD:BP814405.1,INSD:DR246980.1,INSD:EL269098.1,
FT                   INSD:F15457.1,INSD:AV800124.1,INSD:BP565258.1,
FT                   INSD:CF652052.1,INSD:DR352086.1,INSD:BP650338.1,
FT                   INSD:CK117561.1,INSD:BP657959.1,INSD:AV439561.2,
FT                   INSD:DR352074.1,INSD:EL149568.1,INSD:DR352085.1,
FT                   INSD:DR352171.1,INSD:BP570729.1,INSD:EL166336.1,
FT                   INSD:BP649440.1,INSD:BP595613.1,INSD:DR352156.1,
FT                   INSD:DR352106.1,INSD:EL228642.1,INSD:DR352119.1,
FT                   INSD:EH916734.1,INSD:BP585718.1,INSD:EL288508.1,
FT                   INSD:ES097500.1,INSD:DR352170.1,INSD:AV549151.1,
FT                   INSD:EG453633.1,INSD:EG453635.1,INSD:BP642883.1,
FT                   INSD:EL986677.1,INSD:DR352117.1,INSD:DR352172.1,
FT                   INSD:EL280199.1,INSD:BP588289.1,INSD:EH961795.1,
FT                   INSD:AV519115.1,INSD:DR352155.1,INSD:AV800331.1,
FT                   INSD:CK120606.1,INSD:EL131840.1,INSD:DR352161.1,
FT                   INSD:DR352148.1,INSD:EH991607.1,INSD:DR246984.1,
FT                   INSD:AV813143.1,INSD:DR352113.1,INSD:DR246979.1,
FT                   INSD:BP839043.1,INSD:DR352114.1,INSD:EL039470.1,
FT                   INSD:BP633123.1,INSD:EL303183.1,INSD:DR352116.1,
FT                   INSD:BG459232.1,INSD:BP634389.1,INSD:BP798881.1,
FT                   INSD:DR352135.1,INSD:BP644212.1,INSD:EL286442.1,
FT                   INSD:EG453594.1,INSD:DR352112.1,INSD:AV525804.1,
FT                   INSD:DR352138.1,INSD:ES037658.1,INSD:EL317491.1,
FT                   INSD:F15381.1,INSD:DR352154.1,INSD:EH888298.1,
FT                   INSD:AV830477.1,INSD:DR352088.1,INSD:AV817251.1,
FT                   INSD:EL292881.1,INSD:DR373301.1,INSD:BP615848.1,
FT                   INSD:BP621788.1,INSD:DR352108.1,INSD:DR352149.1,
FT                   INSD:AV809265.1,INSD:BP795107.1,INSD:N38597.1,
FT                   INSD:DR352115.1,INSD:DR352087.1,INSD:AV534914.1,
FT                   INSD:BP853022.1,INSD:DR352079.1,INSD:DR352092.1,
FT                   INSD:AV811905.1,INSD:DR352104.1,INSD:BP639863.1,
FT                   INSD:DR352103.1,INSD:BP856523.2,INSD:EH861138.1,
FT                   INSD:BP818588.1,INSD:DR352141.1,INSD:AV800376.1,
FT                   INSD:BP831166.1,INSD:AI997563.1,INSD:BP805266.1,
FT                   INSD:DR352090.1,INSD:BP632713.1,INSD:DR352151.1,
FT                   INSD:F15247.1,INSD:AV524884.1,INSD:DR352166.1,
FT                   INSD:EH881726.1,INSD:EL149694.1,INSD:DR352162.1,
FT                   INSD:DR352174.1,INSD:DR352132.1,INSD:DR352169.1,
FT                   INSD:DR352093.1,INSD:EL168412.1,INSD:DR352150.1,
FT                   INSD:ES012709.1,INSD:DR352167.1,INSD:DR352120.1,
FT                   INSD:EH951509.1,INSD:DR352140.1,INSD:DR352081.1,
FT                   INSD:BP561800.2,INSD:DR352095.1,INSD:T04208.1,
FT                   INSD:DR352091.1,INSD:EH952364.1,INSD:AV549902.1,
FT                   INSD:BP652418.1,INSD:DR352173.1,INSD:EL224229.1,
FT                   INSD:DR246982.1,INSD:DR377761.1,INSD:DR352096.1,
FT                   INSD:BP612159.1,INSD:EL029992.1,INSD:DR352158.1,
FT                   INSD:EL186957.1,INSD:BP628804.1,INSD:DR352133.1,
FT                   INSD:EL132789.1,INSD:DR352101.1,INSD:ES085090.1,
FT                   INSD:DR352168.1,INSD:BP859218.1,INSD:EL049731.1,
FT                   INSD:BP844811.1,INSD:BP624382.1,INSD:DR352122.1,
FT                   INSD:EL977870.1,INSD:BP817063.1,INSD:DR352107.1,
FT                   INSD:BP856743.1,INSD:DR352075.1,INSD:EH860820.1,
FT                   INSD:EG462001.1,INSD:EL112942.1,INSD:EL032099.1,
FT                   INSD:DR352142.1,INSD:DR352082.1,INSD:BP834782.1,
FT                   INSD:EG453598.1,INSD:BP817179.1,INSD:BP619656.1,
FT                   INSD:DR352073.1,INSD:DR352105.1,INSD:AV538882.1,
FT                   INSD:AV536100.1,INSD:BP591526.1,INSD:CK121366.1,
FT                   INSD:DR352153.1,INSD:EL042620.1,INSD:AV808254.1,
FT                   INSD:EL059373.1,INSD:BP858599.1,INSD:EL325357.1,
FT                   INSD:EG462002.1,INSD:BP833855.2,INSD:ES186221.1,
FT                   INSD:BP824957.1,INSD:EL277639.1,INSD:AV524794.1,
FT                   INSD:DR352165.1,INSD:EH918575.1,INSD:EH933626.1,
FT                   INSD:DR352157.1,INSD:BP625236.1,INSD:AV560993.1,
FT                   INSD:EL253219.1,INSD:AU036594.1,INSD:DR352146.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF446352.1,INSD:AF428298.1,INSD:AY972813.1,
FT                   INSD:BX830996.1,INSD:BX831741.1,INSD:BX833592.1,
FT                   INSD:AK227197.1,INSD:BX831631.1,INSD:AY097428.1,
FT                   INSD:AY088650.1"
FT                   /protein_id="AED90340.1"
FT                   /translation="MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAE
FT                   QARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFV
FT                   EAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIR
FT                   TKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLP
FT                   VVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLV
FT                   EVSCGLGEAMVGINLNDEKVERFANRSE"
     MEGTGVVAVY GNGAITEAKK SPFSVKVGLA QMLRGGVIMD VVNAEQARIA EEAGACAVMA        60
     LERVPADIRA QGGVARMSDP QMIKEIKQAV TIPVMAKARI GHFVEAQILE AIGIDYIDES       120
     EVLTLADEDH HINKHNFRIP FVCGCRNLGE ALRRIREGAA MIRTKGEAGT GNIIEAVRHV       180
     RSVNGDIRVL RNMDDDEVFT FAKKLAAPYD LVMQTKQLGR LPVVQFAAGG VATPADAALM       240
     MQLGCDGVFV GSGIFKSGDP ARRARAIVQA VTHYSDPEML VEVSCGLGEA MVGINLNDEK       300
     VERFANRSE                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page