(data stored in ACNUC13479 zone)

EMBL: CP002688.PE78

CP002688.PE78        Location/Qualifiers
FT   CDS             complement(174886..176091)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.130"
FT                   /gene_synonym="T10O8_130"
FT                   /locus_tag="AT5G01420"
FT                   /product="Glutaredoxin family protein"
FT                   /note="Glutaredoxin family protein; FUNCTIONS IN: electron
FT                   carrier activity, protein disulfide oxidoreductase
FT                   activity; INVOLVED IN: cell redox homeostasis; CONTAINS
FT                   InterPro DOMAIN/s: Thioredoxin fold (InterPro:IPR012335),
FT                   Glutaredoxin (InterPro:IPR002109), Thioredoxin-like fold
FT                   (InterPro:IPR012336); BEST Arabidopsis thaliana protein
FT                   match is: Glutaredoxin family protein (TAIR:AT5G06470.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01420"
FT                   /db_xref="GOA:Q9M031"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M031"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP839789.1,INSD:BP639998.1,INSD:BP658010.1,
FT                   INSD:BP828460.1,INSD:BP839875.1,INSD:AU238836.1,
FT                   INSD:AU230083.1,INSD:EL051293.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005349.1,INSD:AK117993.1"
FT                   /protein_id="AED90341.1"
FT                   /translation="MKSSRMKFAKKLKSIRAGEYLNQDRILQVLSAADEFLPKISNHIP
FT                   QITSAASIWRTPQKSENQIANVTELLENVRQGEEEASGNFVGDEENVRPPVNQIPRVPC
FT                   DRKESKLAVSCGSDTGIGRKSFGSGFRRPDLNSTTLFDPKLLEAFELAALCFRKIKDFS
FT                   REARVNDEDDIVFPEEEEIRKDGNSIPPVISVVEYRRKDENVVVLHKDDGNALQIVNAI
FT                   REEVIGEEDIGKDGNTLMDPLLEFEERCPPGGEESVVFYTTTLRGIRKTFDDCNMIRFL
FT                   LDSFKVKYYERDVSMHREYREELRRISAAETEVLPPVLFVKGRCIGGAQRVLGLHEQGK
FT                   FKILFEGIPITGDERCRRCDGFRFLMCDGCRGSRRIISGDGSRIQCLICNENGLIVCVG
FT                   CS"
     MKSSRMKFAK KLKSIRAGEY LNQDRILQVL SAADEFLPKI SNHIPQITSA ASIWRTPQKS        60
     ENQIANVTEL LENVRQGEEE ASGNFVGDEE NVRPPVNQIP RVPCDRKESK LAVSCGSDTG       120
     IGRKSFGSGF RRPDLNSTTL FDPKLLEAFE LAALCFRKIK DFSREARVND EDDIVFPEEE       180
     EIRKDGNSIP PVISVVEYRR KDENVVVLHK DDGNALQIVN AIREEVIGEE DIGKDGNTLM       240
     DPLLEFEERC PPGGEESVVF YTTTLRGIRK TFDDCNMIRF LLDSFKVKYY ERDVSMHREY       300
     REELRRISAA ETEVLPPVLF VKGRCIGGAQ RVLGLHEQGK FKILFEGIPI TGDERCRRCD       360
     GFRFLMCDGC RGSRRIISGD GSRIQCLICN ENGLIVCVGC S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page