(data stored in ACNUC13479 zone)

EMBL: CP002688.PE79

CP002688.PE79        Location/Qualifiers
FT   CDS             complement(join(176797..176835,177094..177175,
FT                   177258..177355,177477..177557,177657..177748,
FT                   177980..178010))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.140"
FT                   /locus_tag="AT5G01430"
FT                   /product="Got1/Sft2-like vescicle transport protein family"
FT                   /note="Got1/Sft2-like vescicle transport protein family;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   vesicle-mediated transport; LOCATED IN: cellular_component
FT                   unknown; CONTAINS InterPro DOMAIN/s: Vesicle transport
FT                   protein, Got1/SFT2-like (InterPro:IPR007305); BEST
FT                   Arabidopsis thaliana protein match is: Got1/Sft2-like
FT                   vescicle transport protein family (TAIR:AT3G49420.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SCL4"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SCL4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL015564.1,INSD:DR202398.1,INSD:EL996615.1,
FT                   INSD:EG493885.1,INSD:EG510992.1,INSD:DR202393.1,
FT                   INSD:DR202392.1,INSD:BP868444.1,INSD:AI997074.1,
FT                   INSD:DR202399.1,INSD:EG510993.1,INSD:EL234465.1,
FT                   INSD:DR202397.1,INSD:EL274506.1,INSD:EL984885.1,
FT                   INSD:EL981768.1,INSD:EH802716.1,INSD:R65541.1,
FT                   INSD:ES011278.1,INSD:DR202395.1,INSD:DR202396.1,
FT                   INSD:BP792814.1,INSD:ES073775.1,INSD:ES180121.1,
FT                   INSD:AV808503.1,INSD:BP630578.1,INSD:EL312372.1,
FT                   INSD:DR202391.1,INSD:DR376757.1,INSD:N37638.1,
FT                   INSD:EH867479.1,INSD:AV791663.1,INSD:DR202390.1,
FT                   INSD:DR202394.1,INSD:AI994104.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091202.1,INSD:AY045875.1"
FT                   /protein_id="AED90342.1"
FT                   /translation="MMSFEMNDRKKIGLGLTGFGVFFSFLGIVFVFDKGLLAMGNILFI
FT                   SGVSLTIGFKSTMQFFMKRQNYKGTISFGVGFFFVIIGWPILGMMLETYGFFVLFSGFW
FT                   PTLAVFAQKIPVLGWIIQQPYIRSFFDKYRGKRVPV"
     MMSFEMNDRK KIGLGLTGFG VFFSFLGIVF VFDKGLLAMG NILFISGVSL TIGFKSTMQF        60
     FMKRQNYKGT ISFGVGFFFV IIGWPILGMM LETYGFFVLF SGFWPTLAVF AQKIPVLGWI       120
     IQQPYIRSFF DKYRGKRVPV                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page