(data stored in ACNUC13479 zone)

EMBL: CP002688.PE8

CP002688.PE8         Location/Qualifiers
FT   CDS             complement(join(5516..5576,5687..5769))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01015"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01015"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01015.2"
FT                   /db_xref="GOA:F4K7W9"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7W9"
FT                   /protein_id="AED90287.1"
FT                   /translation="MESSLHSVIFLGLLATILVTTNGQGEYVRRDGAKCRRNVASGGGD
FT                   GV"
     MESSLHSVIF LGLLATILVT TNGQGEYVRR DGAKCRRNVA SGGGDGV                      47
//

If you have problems or comments...

PBIL Back to PBIL home page