(data stored in ACNUC13479 zone)

EMBL: CP002688.PE80

CP002688.PE80        Location/Qualifiers
FT   CDS             complement(join(176797..176835,177094..177175,
FT                   177258..177355,177477..177557,177657..177748,
FT                   177980..178010))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.140"
FT                   /locus_tag="AT5G01430"
FT                   /product="Got1/Sft2-like vescicle transport protein family"
FT                   /note="Got1/Sft2-like vescicle transport protein family;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   vesicle-mediated transport; LOCATED IN: cellular_component
FT                   unknown; CONTAINS InterPro DOMAIN/s: Vesicle transport
FT                   protein, Got1/SFT2-like (InterPro:IPR007305); BEST
FT                   Arabidopsis thaliana protein match is: Got1/Sft2-like
FT                   vescicle transport protein family (TAIR:AT3G49420.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01430"
FT                   /db_xref="GOA:Q9SCL4"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SCL4"
FT                   /protein_id="AED90343.1"
FT                   /translation="MMSFEMNDRKKIGLGLTGFGVFFSFLGIVFVFDKGLLAMGNILFI
FT                   SGVSLTIGFKSTMQFFMKRQNYKGTISFGVGFFFVIIGWPILGMMLETYGFFVLFSGFW
FT                   PTLAVFAQKIPVLGWIIQQPYIRSFFDKYRGKRVPV"
     MMSFEMNDRK KIGLGLTGFG VFFSFLGIVF VFDKGLLAMG NILFISGVSL TIGFKSTMQF        60
     FMKRQNYKGT ISFGVGFFFV IIGWPILGMM LETYGFFVLF SGFWPTLAVF AQKIPVLGWI       120
     IQQPYIRSFF DKYRGKRVPV                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page