(data stored in ACNUC13479 zone)

EMBL: CP002688.PE81

CP002688.PE81        Location/Qualifiers
FT   CDS             join(179822..179914,179995..180098,180211..180355,
FT                   180442..180545,180713..180922,181007..181190,
FT                   181248..181283)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.150"
FT                   /gene_synonym="T10O8_150"
FT                   /locus_tag="AT5G01440"
FT                   /product="hypothetical protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   Insulinase (Peptidase family M16) family protein
FT                   (TAIR:AT1G06900.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01440"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01440.1"
FT                   /db_xref="GOA:F4K9D7"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D7"
FT                   /protein_id="AED90344.1"
FT                   /translation="MSLREREIFPCAKRKTDVKVKNKFESNSLAKVYFRIKCEKAQEAR
FT                   QTALLNLFVSIISDSVYNKLRIEEKLGYLVECETRLIHGVGFYVCVVSSDYNPCHLVRR
FT                   IYKFMNGIRLEGLFDKMFKDFKNGVSSKLPHDSGKTKWSEIVRESCIFDFYSEEKKELS
FT                   LITKNDLIEWYKRYVRLSSPKCCSFVVSIWGCNTKNGLEKVKILRLRRKMKVKKKQGSA
FT                   SQVNSIGQEMNTSLLMLVAKKMESFYKLMRVRQTLNYAEARNYVSLKRPWIAETVVTQS
FT                   NESIERRSKR"
     MSLREREIFP CAKRKTDVKV KNKFESNSLA KVYFRIKCEK AQEARQTALL NLFVSIISDS        60
     VYNKLRIEEK LGYLVECETR LIHGVGFYVC VVSSDYNPCH LVRRIYKFMN GIRLEGLFDK       120
     MFKDFKNGVS SKLPHDSGKT KWSEIVRESC IFDFYSEEKK ELSLITKNDL IEWYKRYVRL       180
     SSPKCCSFVV SIWGCNTKNG LEKVKILRLR RKMKVKKKQG SASQVNSIGQ EMNTSLLMLV       240
     AKKMESFYKL MRVRQTLNYA EARNYVSLKR PWIAETVVTQ SNESIERRSK R                291
//

If you have problems or comments...

PBIL Back to PBIL home page