(data stored in ACNUC13479 zone)

EMBL: CP002688.PE82

CP002688.PE82        Location/Qualifiers
FT   CDS             complement(join(182013..182151,182239..182312,
FT                   182398..182526))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01445"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: mitochondrion; Has 5 Blast hits to 5 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 5; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01445"
FT                   /db_xref="GOA:F4K9D8"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP656584.1,INSD:EL176842.1,INSD:BP833004.1,
FT                   INSD:CD532929.1,INSD:BP812446.1,INSD:CD532933.1,
FT                   INSD:EH987864.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK221153.1"
FT                   /protein_id="AED90345.1"
FT                   /translation="MGRIYAHHAYRASFCSQIHICVSRLQVRSYTTNPRFARRYDFEEK
FT                   LSPDVTESQEKLLSPDVSDSSTSVAKQFQSSSKMRFLHKHKAFKMKKKKKMLVKPPSPK
FT                   KNLQCFIKT"
     MGRIYAHHAY RASFCSQIHI CVSRLQVRSY TTNPRFARRY DFEEKLSPDV TESQEKLLSP        60
     DVSDSSTSVA KQFQSSSKMR FLHKHKAFKM KKKKKMLVKP PSPKKNLQCF IKT              113
//

If you have problems or comments...

PBIL Back to PBIL home page