(data stored in ACNUC13479 zone)

EMBL: CP002688.PE84

CP002688.PE84        Location/Qualifiers
FT   CDS             join(186823..187172,187270..187355,187542..187657,
FT                   187775..187885,188070..188168,188291..188413,
FT                   188695..188757,188840..188904,189004..189113,
FT                   189215..189329,189424..189489,189592..189702,
FT                   189792..189858,189961..190008)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.170"
FT                   /gene_synonym="T10O8_170"
FT                   /locus_tag="AT5G01460"
FT                   /product="LMBR1-like membrane protein"
FT                   /note="LMBR1-like membrane protein; CONTAINS InterPro
FT                   DOMAIN/s: LMBR1-like membrane protein, conserved region
FT                   (InterPro:IPR006876); BEST Arabidopsis thaliana protein
FT                   match is: LMBR1-like membrane protein (TAIR:AT3G08930.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M028"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M028"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP865699.1,INSD:ES115394.1,INSD:EH980055.1,
FT                   INSD:ES015089.1,INSD:W43054.1,INSD:EH805853.1,
FT                   INSD:ES079886.1,INSD:EL972956.1,INSD:EL978699.1,
FT                   INSD:BP577633.1,INSD:ES066328.1,INSD:BP777596.1,
FT                   INSD:BP580890.1,INSD:AV808958.1,INSD:ES058672.1,
FT                   INSD:AV548573.1,INSD:EL164587.1,INSD:ES021574.1,
FT                   INSD:EH989321.1,INSD:ES184047.1,INSD:AV538129.1,
FT                   INSD:EL297477.1,INSD:EL301566.1,INSD:EH906382.1,
FT                   INSD:ES059636.1,INSD:EH859368.1,INSD:ES157284.1,
FT                   INSD:EL320410.1,INSD:EL017897.1,INSD:EH850088.1,
FT                   INSD:DR362649.1,INSD:ES146401.1,INSD:AV804746.1,
FT                   INSD:EH826817.1,INSD:EL104442.1,INSD:DR269546.1,
FT                   INSD:EL222240.1,INSD:ES083719.1,INSD:EH892503.1,
FT                   INSD:BP780727.1,INSD:EL175757.1,INSD:EL170995.1,
FT                   INSD:EL134969.1,INSD:ES097719.1,INSD:AV558344.1,
FT                   INSD:AV810629.1,INSD:ES039604.1,INSD:DR383432.1,
FT                   INSD:EL249322.1,INSD:ES085915.1,INSD:BP788146.1,
FT                   INSD:EH828938.1,INSD:AI999226.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096440.1,INSD:AY072197.1"
FT                   /protein_id="AED90347.1"
FT                   /translation="MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFV
FT                   VVFGLSIAMISILMLPADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAVLVFFII
FT                   PFAMFFYEGDQDKALGKRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHLSSATT
FT                   TFPTSWQFSNNQPCIGNTARQCSAYTANAASEKTWSMRTTFPEYVVALATIVGSVLFTI
FT                   FGGVGIACLPLGLITAFIRRPKAVITRSQYIKEATELGKKARDLKKAADALHQEERSGA
FT                   KGRKWRKNVKAVEKELLQLEEDVNLLEEMYPQGEQAETAWAFTVLGYLAKFVLGILGLI
FT                   VSVAWIAHIIIYLLVDPPLSPFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMM
FT                   LGLKLVFITIHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFG
FT                   HTLQSLRGIKYLYKYNVFQIGFVVLAGLTFLYYIAFGWRRKKPSGRFQLST"
     MGDFNLALVI VAIVVCVIVF ISSIYLLVNY QHPDDANQAY FPKFVVVFGL SIAMISILML        60
     PADVANRHAC RHSIYNGACN LTLPMKDLWL AVYIVDAVLV FFIIPFAMFF YEGDQDKALG       120
     KRIKSALIWV VTTAVVCALV LGILYGVIGK VDFSVRHLSS ATTTFPTSWQ FSNNQPCIGN       180
     TARQCSAYTA NAASEKTWSM RTTFPEYVVA LATIVGSVLF TIFGGVGIAC LPLGLITAFI       240
     RRPKAVITRS QYIKEATELG KKARDLKKAA DALHQEERSG AKGRKWRKNV KAVEKELLQL       300
     EEDVNLLEEM YPQGEQAETA WAFTVLGYLA KFVLGILGLI VSVAWIAHII IYLLVDPPLS       360
     PFLNEVFIKL DDVWGLLGTA AFAFFCFYLL LAVIAGAMML GLKLVFITIH PMKWGATLMN       420
     SFLFNVGLIL LCSISVIQFC ATAFGYYAQA TAAQEIFGHT LQSLRGIKYL YKYNVFQIGF       480
     VVLAGLTFLY YIAFGWRRKK PSGRFQLST                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page