(data stored in ACNUC13479 zone)

EMBL: CP002688.PE85

CP002688.PE85        Location/Qualifiers
FT   CDS             join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192227,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BE87"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE87"
FT                   /protein_id="ANM69916.1"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLYVKQYPNLIKSLTFLLKKYKPTNVVSPAEGKLNGADTELPR
FT                   PVFLMSWRRRIGKDDESLFFTGCEEAGLEVKHLGNRVYCIKLRESNL"
     MGTHYINRWR NTASRLANNN STSDMDIALF SPASLFAADG DSSDGETTET SQNFVERNHQ        60
     FPGIELQIRE FGFHQLNANL LWPGTFAFAD WLLQHRYLIE RRRCLEIGSG TGALAIFLKK       120
     EFNLDITTSD YNDQEIEDNI VHNCIANKII PSLPHIKHTW GDEFPISEPD WDLIIASDIL       180
     LYVKQYPNLI KSLTFLLKKY KPTNVVSPAE GKLNGADTEL PRPVFLMSWR RRIGKDDESL       240
     FFTGCEEAGL EVKHLGNRVY CIKLRESNL                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page