(data stored in ACNUC13479 zone)

EMBL: CP002688.PE86

CP002688.PE86        Location/Qualifiers
FT   CDS             join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192215,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BE92"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE92"
FT                   /protein_id="ANM69918.1"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLYVKQYPNLIKSLTFLLKKYKPTNVVSPAEGADTELPRPVFL
FT                   MSWRRRIGKDDESLFFTGCEEAGLEVKHLGNRVYCIKLRESNL"
     MGTHYINRWR NTASRLANNN STSDMDIALF SPASLFAADG DSSDGETTET SQNFVERNHQ        60
     FPGIELQIRE FGFHQLNANL LWPGTFAFAD WLLQHRYLIE RRRCLEIGSG TGALAIFLKK       120
     EFNLDITTSD YNDQEIEDNI VHNCIANKII PSLPHIKHTW GDEFPISEPD WDLIIASDIL       180
     LYVKQYPNLI KSLTFLLKKY KPTNVVSPAE GADTELPRPV FLMSWRRRIG KDDESLFFTG       240
     CEEAGLEVKH LGNRVYCIKL RESNL                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page