(data stored in ACNUC13479 zone)

EMBL: CP002688.PE87

CP002688.PE87        Location/Qualifiers
FT   CDS             join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192215,
FT                   192302..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 12 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Methyltransferase-16, putative
FT                   (InterPro:IPR019410); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.3"
FT                   /db_xref="GOA:B3H734"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3H734"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:R65525.1,INSD:BE524948.1,
FT                   INSD:DR296895.1,INSD:EL272610.1,INSD:EL289005.1"
FT                   /protein_id="AED90350.2"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLYVKQYPNLIKSLTFLLKKYKPTNVVSPAEDTELPRPVFLMS
FT                   WRRRIGKDDESLFFTGCEEAGLEVKHLGNRVYCIKLRESNL"
     MGTHYINRWR NTASRLANNN STSDMDIALF SPASLFAADG DSSDGETTET SQNFVERNHQ        60
     FPGIELQIRE FGFHQLNANL LWPGTFAFAD WLLQHRYLIE RRRCLEIGSG TGALAIFLKK       120
     EFNLDITTSD YNDQEIEDNI VHNCIANKII PSLPHIKHTW GDEFPISEPD WDLIIASDIL       180
     LYVKQYPNLI KSLTFLLKKY KPTNVVSPAE DTELPRPVFL MSWRRRIGKD DESLFFTGCE       240
     EAGLEVKHLG NRVYCIKLRE SNL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page