(data stored in ACNUC13479 zone)

EMBL: CP002688.PE88

CP002688.PE88        Location/Qualifiers
FT   CDS             join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192134)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BEC4"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BEC4"
FT                   /protein_id="ANM69917.1"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLCKYPFPIRFIGKLYIYIFTFGFSQM"
     MGTHYINRWR NTASRLANNN STSDMDIALF SPASLFAADG DSSDGETTET SQNFVERNHQ        60
     FPGIELQIRE FGFHQLNANL LWPGTFAFAD WLLQHRYLIE RRRCLEIGSG TGALAIFLKK       120
     EFNLDITTSD YNDQEIEDNI VHNCIANKII PSLPHIKHTW GDEFPISEPD WDLIIASDIL       180
     LCKYPFPIRF IGKLYIYIFT FGFSQM                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page