(data stored in ACNUC13479 zone)

EMBL: CP002688.PE89

CP002688.PE89        Location/Qualifiers
FT   CDS             join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192227,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 12 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Methyltransferase-16, putative
FT                   (InterPro:IPR019410); Has 375 Blast hits to 375 proteins in
FT                   142 species: Archae - 2; Bacteria - 36; Metazoa - 120;
FT                   Fungi - 106; Plants - 76; Viruses - 0; Other Eukaryotes -
FT                   35 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.2"
FT                   /db_xref="GOA:A8MS01"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8MS01"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:BE524948.1,INSD:DR296895.1,
FT                   INSD:EL272610.1,INSD:EL289005.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT014727.1,INSD:BT015510.1"
FT                   /protein_id="AED90349.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLYVKQYP
FT                   NLIKSLTFLLKKYKPTNVVSPAEGKLNGADTELPRPVFLMSWRRRIGKDDESLFFTGCE
FT                   EAGLEVKHLGNRVYCIKLRESNL"
     MDIALFSPAS LFAADGDSSD GETTETSQNF VERNHQFPGI ELQIREFGFH QLNANLLWPG        60
     TFAFADWLLQ HRYLIERRRC LEIGSGTGAL AIFLKKEFNL DITTSDYNDQ EIEDNIVHNC       120
     IANKIIPSLP HIKHTWGDEF PISEPDWDLI IASDILLYVK QYPNLIKSLT FLLKKYKPTN       180
     VVSPAEGKLN GADTELPRPV FLMSWRRRIG KDDESLFFTG CEEAGLEVKH LGNRVYCIKL       240
     RESNL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page