(data stored in ACNUC13479 zone)

EMBL: CP002688.PE9

CP002688.PE9         Location/Qualifiers
FT   CDS             complement(join(6309..6790,7212..7335,7440..7576,
FT                   7705..8139,8216..8270))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.5"
FT                   /gene_synonym="F7J8_5"
FT                   /locus_tag="AT5G01020"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine kinase activity, protein kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   protein amino acid phosphorylation, N-terminal protein
FT                   myristoylation; LOCATED IN: plasma membrane; EXPRESSED IN:
FT                   22 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271); BEST Arabidopsis thaliana
FT                   protein match is: Protein kinase superfamily protein
FT                   (TAIR:AT2G05940.1); Has 117465 Blast hits to 116000
FT                   proteins in 4235 species: Archae - 97; Bacteria - 13843;
FT                   Metazoa - 43298; Fungi - 9750; Plants - 33095; Viruses -
FT                   372; Other Eukaryotes - 17010 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01020"
FT                   /db_xref="GOA:Q8GXZ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXZ3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV542668.1,INSD:DR367882.1,INSD:EL166751.1,
FT                   INSD:AJ609355.1,INSD:BP604386.1,INSD:ES201609.1,
FT                   INSD:EH846774.1,INSD:EL064159.1,INSD:EL164792.1,
FT                   INSD:AV816823.1,INSD:DR384217.1,INSD:EL077815.1,
FT                   INSD:AV797668.1,INSD:AV542256.1,INSD:BP791525.1,
FT                   INSD:AV811734.1,INSD:EH968086.1,INSD:DR367880.1,
FT                   INSD:EL082000.1,INSD:BP595609.1,INSD:BP632365.1,
FT                   INSD:ES102947.1,INSD:EL986414.1,INSD:BP622018.1,
FT                   INSD:BP588566.1,INSD:BP782136.1,INSD:ES022685.1,
FT                   INSD:ES092126.1,INSD:BP842708.1,INSD:EH976832.1,
FT                   INSD:ES066402.1,INSD:AV802485.1,INSD:EH836279.1,
FT                   INSD:ES157759.1,INSD:EH800126.1,INSD:EH851418.1,
FT                   INSD:CK120262.1,INSD:AV796565.1,INSD:EL155280.1,
FT                   INSD:EL005719.1,INSD:AV548064.1,INSD:EL324324.1,
FT                   INSD:ES003251.1,INSD:BE524804.1,INSD:BP585141.1,
FT                   INSD:AV550934.1,INSD:EL122246.1,INSD:EH953542.1,
FT                   INSD:ES153720.1,INSD:BP639299.1,INSD:EL079478.1,
FT                   INSD:EL033061.1,INSD:BP590578.1,INSD:AU238791.1,
FT                   INSD:EL164496.1,INSD:EH861276.1,INSD:ES072473.1,
FT                   INSD:EL270504.1,INSD:DR367879.1,INSD:BP787589.1,
FT                   INSD:BP637739.1,INSD:EH978602.1,INSD:EH912905.1,
FT                   INSD:ES058180.1,INSD:ES192104.1,INSD:BP848471.1,
FT                   INSD:EL253453.1,INSD:EH861733.1,INSD:CD534902.1,
FT                   INSD:ES172155.1,INSD:BP779449.1,INSD:EG490591.1,
FT                   INSD:CB262176.1,INSD:BP830687.1,INSD:ES045525.1,
FT                   INSD:EG449293.1,INSD:AB015116.1,INSD:BP833138.1,
FT                   INSD:EL029423.1,INSD:AV543230.1,INSD:EH847199.1,
FT                   INSD:EH835634.1,INSD:AV538629.1,INSD:EH984307.1,
FT                   INSD:BP784060.1,INSD:EL166811.1,INSD:BP664332.1,
FT                   INSD:EL321014.1,INSD:EL999290.1,INSD:EL197413.1,
FT                   INSD:DR367881.1,INSD:EL982126.1,INSD:AV546210.1,
FT                   INSD:AV535079.1,INSD:AA042233.1,INSD:AV537963.1,
FT                   INSD:BP791271.1,INSD:ES140772.1,INSD:EL085367.1,
FT                   INSD:EG449294.1,INSD:ES154156.1,INSD:CK119614.1,
FT                   INSD:BU635172.1,INSD:BP784902.1,INSD:EH875908.1,
FT                   INSD:AV531031.1,INSD:BP842769.1,INSD:BP594979.1,
FT                   INSD:AV558877.1,INSD:DR367878.1,INSD:EH895128.1,
FT                   INSD:BP635372.1,INSD:BP605875.1,INSD:ES125260.1,
FT                   INSD:AI992536.1,INSD:EL176246.1,INSD:ES154423.1,
FT                   INSD:EH989465.1,INSD:EH908113.1,INSD:BP860122.1,
FT                   INSD:EH797563.1,INSD:DR367877.1,INSD:EL112964.1,
FT                   INSD:EH900171.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831068.1,INSD:BX832571.1,INSD:AK117952.1"
FT                   /protein_id="AED90288.1"
FT                   /translation="MGNCGTRDEAAVFTPQAQAQQLQKKHSRSVSDLSDPSTPRFRDDS
FT                   RTPISYAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAVK
FT                   VLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMLRGSLENHLFR
FT                   KTTAPLSWSRRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAK
FT                   AGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRP
FT                   SKEQNLVDWARPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMS
FT                   DVVETLEPLQCTGDALIPCATTTAGAAFAMGGVPDYRMHRRFAKNVGPGAICRSPNPNY
FT                   SPGGPAACRVR"
     MGNCGTRDEA AVFTPQAQAQ QLQKKHSRSV SDLSDPSTPR FRDDSRTPIS YAQVIPFTLF        60
     ELETITKSFR PDYILGEGGF GTVYKGYIDD NLRVGLKSLP VAVKVLNKEG LQGHREWLTE       120
     VNFLGQLRHP NLVKLIGYCC EDDHRLLVYE FMLRGSLENH LFRKTTAPLS WSRRMMIALG       180
     AAKGLAFLHN AERPVIYRDF KTSNILLDSD YTAKLSDFGL AKAGPQGDET HVSTRVMGTY       240
     GYAAPEYVMT GHLTARSDVY SFGVVLLEML TGRKSVDKTR PSKEQNLVDW ARPKLNDKRK       300
     LLQIIDPRLE NQYSVRAAQK ACSLAYYCLS QNPKARPLMS DVVETLEPLQ CTGDALIPCA       360
     TTTAGAAFAM GGVPDYRMHR RFAKNVGPGA ICRSPNPNYS PGGPAACRVR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page