(data stored in ACNUC13479 zone)

EMBL: CP002688.PE90

CP002688.PE90        Location/Qualifiers
FT   CDS             join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192215,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; CONTAINS InterPro DOMAIN/s:
FT                   Methyltransferase-16, putative (InterPro:IPR019410); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.1"
FT                   /db_xref="GOA:Q8LCT7"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LCT7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:BE524948.1,INSD:DR296895.1,
FT                   INSD:EL272610.1,INSD:EL289005.1,INSD:DR381642.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086411.1,INSD:BX833040.1,INSD:BT025168.1"
FT                   /protein_id="AED90348.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLYVKQYP
FT                   NLIKSLTFLLKKYKPTNVVSPAEGADTELPRPVFLMSWRRRIGKDDESLFFTGCEEAGL
FT                   EVKHLGNRVYCIKLRESNL"
     MDIALFSPAS LFAADGDSSD GETTETSQNF VERNHQFPGI ELQIREFGFH QLNANLLWPG        60
     TFAFADWLLQ HRYLIERRRC LEIGSGTGAL AIFLKKEFNL DITTSDYNDQ EIEDNIVHNC       120
     IANKIIPSLP HIKHTWGDEF PISEPDWDLI IASDILLYVK QYPNLIKSLT FLLKKYKPTN       180
     VVSPAEGADT ELPRPVFLMS WRRRIGKDDE SLFFTGCEEA GLEVKHLGNR VYCIKLRESN       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page