(data stored in ACNUC13479 zone)

EMBL: CP002688.PE91

CP002688.PE91        Location/Qualifiers
FT   CDS             join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192134)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BE89"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE89"
FT                   /protein_id="ANM69915.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLCKYPFP
FT                   IRFIGKLYIYIFTFGFSQM"
     MDIALFSPAS LFAADGDSSD GETTETSQNF VERNHQFPGI ELQIREFGFH QLNANLLWPG        60
     TFAFADWLLQ HRYLIERRRC LEIGSGTGAL AIFLKKEFNL DITTSDYNDQ EIEDNIVHNC       120
     IANKIIPSLP HIKHTWGDEF PISEPDWDLI IASDILLCKY PFPIRFIGKL YIYIFTFGFS       180
     QM                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page