(data stored in ACNUC13479 zone)

EMBL: CP002688.PE92

CP002688.PE92        Location/Qualifiers
FT   CDS             192990..194231
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.1"
FT                   /locus_tag="AT5G01480"
FT                   /product="Cysteine/Histidine-rich C1 domain family protein"
FT                   /note="Cysteine/Histidine-rich C1 domain family protein;
FT                   FUNCTIONS IN: zinc ion binding; INVOLVED IN: intracellular
FT                   signaling pathway; LOCATED IN: cellular_component unknown;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase C-like, phorbol
FT                   ester/diacylglycerol binding (InterPro:IPR002219), DC1
FT                   (InterPro:IPR004146), Zinc finger, PHD-type
FT                   (InterPro:IPR001965), C1-like (InterPro:IPR011424); BEST
FT                   Arabidopsis thaliana protein match is:
FT                   Cysteine/Histidine-rich C1 domain family protein
FT                   (TAIR:AT2G02610.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01480"
FT                   /db_xref="GOA:Q9M026"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M026"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI994631.1,INSD:AA651112.1"
FT                   /protein_id="AED90351.1"
FT                   /translation="MHHLDHTPSDRLLCPVERIQKDKDGKVTTISGGIHYIIKSSYFIS
FT                   NAEDEKPVHLLSLILRNRKEDKVLSFTFCYVCQIALLGEAYYVYFCSYCPNYYHKECVE
FT                   SPSVFHSSDHPKHPLQLLWIPDMSLEEERDKRCCSCKRGVDALFYYCSICDFAVHMACA
FT                   GNPTSPTIDNPKRHKHTLHYFPRKSGLFCDVCALVDDSDYLYVCLLCDFIVHKRCVYLP
FT                   YVIKVSRHNHRLTFTPNLPYEEPTVTDCGVCHAKINENYGEYSCTKKGCVYAVHSRCAM
FT                   QSDVCDGKKLEGEPEEVYEDTKMFEEKGDGIIQHQSHPRHQLRLEKIFHDESHHCQACR
FT                   RPSYDHGGNVYRCMQCDDFIFHESCAYLPRTKQFMLHVHPLTLDPSYNFIDWFQCGKCY
FT                   RYSCGFRCMCSCAV"
     MHHLDHTPSD RLLCPVERIQ KDKDGKVTTI SGGIHYIIKS SYFISNAEDE KPVHLLSLIL        60
     RNRKEDKVLS FTFCYVCQIA LLGEAYYVYF CSYCPNYYHK ECVESPSVFH SSDHPKHPLQ       120
     LLWIPDMSLE EERDKRCCSC KRGVDALFYY CSICDFAVHM ACAGNPTSPT IDNPKRHKHT       180
     LHYFPRKSGL FCDVCALVDD SDYLYVCLLC DFIVHKRCVY LPYVIKVSRH NHRLTFTPNL       240
     PYEEPTVTDC GVCHAKINEN YGEYSCTKKG CVYAVHSRCA MQSDVCDGKK LEGEPEEVYE       300
     DTKMFEEKGD GIIQHQSHPR HQLRLEKIFH DESHHCQACR RPSYDHGGNV YRCMQCDDFI       360
     FHESCAYLPR TKQFMLHVHP LTLDPSYNFI DWFQCGKCYR YSCGFRCMCS CAV              413
//

If you have problems or comments...

PBIL Back to PBIL home page