(data stored in ACNUC13479 zone)

EMBL: CP002688.PE98

CP002688.PE98        Location/Qualifiers
FT   CDS             join(206797..206861,207453..207603,207703..207769,
FT                   207867..208101,208170)
FT                   /codon_start=1
FT                   /gene="AIRP2"
FT                   /gene_synonym="F7A7.40"
FT                   /gene_synonym="F7A7_40"
FT                   /gene_synonym="ABA Insensitive RING Protein 2"
FT                   /gene_synonym="AtAIRP2"
FT                   /locus_tag="AT5G01520"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, RING-type, conserved site
FT                   (InterPro:IPR017907); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G47160.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01520"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01520.2"
FT                   /db_xref="GOA:Q9M022"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M022"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200245.1,INSD:CB257492.1,INSD:T22636.1,
FT                   INSD:ES024579.1,INSD:ES004530.1,INSD:ES019253.1,
FT                   INSD:EH934658.1,INSD:BP843186.1,INSD:AV826358.1,
FT                   INSD:BP660462.1,INSD:EL295849.1,INSD:ES071674.1,
FT                   INSD:N96366.1,INSD:T43550.1,INSD:BP804842.1,
FT                   INSD:ES152097.1,INSD:AV564168.1,INSD:ES086864.1,
FT                   INSD:ES089210.1,INSD:ES113693.1,INSD:BP856644.1,
FT                   INSD:AV827590.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF370144.1,INSD:AY056355.1"
FT                   /protein_id="AED90355.1"
FT                   /translation="MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAA
FT                   HLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQL
FT                   HGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNH
FT                   SMCINCYRN"
     MRKSFKDSLK ALEADIQFAN TLASEYPEEY DGGYVQMRLS YSPAAHLFLF LLQWTDCHFA        60
     GALGLLRILI YKAYVDGKTT MSLHERKTSI REFYDVLFPS LLQLHGGITD VEERKQKEIC       120
     DKRYRKKDRT DKGKMSEIDL EREEECGICL EIRNKVVLPT CNHSMCINCY RN               172
//

If you have problems or comments...

PBIL Back to PBIL home page