(data stored in ACNUC13479 zone)

EMBL: CP002688.PRA1.B5

CP002688.PRA1.B5     Location/Qualifiers
FT   CDS             complement(241442..242113)
FT                   /codon_start=1
FT                   /gene="PRA1.B5"
FT                   /gene_synonym="F7A7.160"
FT                   /gene_synonym="F7A7_160"
FT                   /gene_synonym="prenylated RAB acceptor 1.B5"
FT                   /locus_tag="AT5G01640"
FT                   /product="prenylated RAB acceptor 1.B5"
FT                   /note="prenylated RAB acceptor 1.B5 (PRA1.B5); CONTAINS
FT                   InterPro DOMAIN/s: Prenylated rab acceptor PRA1
FT                   (InterPro:IPR004895); BEST Arabidopsis thaliana protein
FT                   match is: prenylated RAB acceptor 1.B4 (TAIR:AT2G38360.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M012"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M012"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP561368.2,INSD:ES179858.1,INSD:EG451121.1,
FT                   INSD:CK120161.1,INSD:EG451124.1,INSD:AV789803.1,
FT                   INSD:BP790051.1,INSD:EL114233.1,INSD:EG451123.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000918.1,INSD:AY090930.1"
FT                   /protein_id="AED90370.1"
FT                   /translation="MVSTNPPVLPISTTATDTTNQPPIVTAVVESQPPVVRAFVNGVTE
FT                   TVCGGLSRSRPWSELLDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLA
FT                   HPFSLILLLCLAASWLFLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGS
FT                   VLISALMIGIATICVHGAFRAPDDLFLDEQDHAASGFLSFIGVPAIPSVAPSASSAASP
FT                   V"
     MVSTNPPVLP ISTTATDTTN QPPIVTAVVE SQPPVVRAFV NGVTETVCGG LSRSRPWSEL        60
     LDRSAFTKPD SLSEAGTRFR KNSSYFRVNY VCIVALILGF SLLAHPFSLI LLLCLAASWL       120
     FLYLFRPSDR PLILFGRSFS EYETLGGLIL STIAVIFFTS VGSVLISALM IGIATICVHG       180
     AFRAPDDLFL DEQDHAASGF LSFIGVPAIP SVAPSASSAA SPV                         223
//

If you have problems or comments...

PBIL Back to PBIL home page