(data stored in ACNUC13479 zone)

EMBL: CP002688.PTR5

CP002688.PTR5        Location/Qualifiers
FT   CDS             complement(join(61257..62091,62166..62716,62818..63035,
FT                   63132..63240))
FT                   /codon_start=1
FT                   /gene="PTR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 5"
FT                   /gene_synonym="AtNPF8.2"
FT                   /gene_synonym="ATPTR5"
FT                   /gene_synonym="F7J8.160"
FT                   /gene_synonym="F7J8_160"
FT                   /gene_synonym="NPF8.2"
FT                   /gene_synonym="NRT1/ PTR family 8.2"
FT                   /gene_synonym="peptide transporter 5"
FT                   /locus_tag="AT5G01180"
FT                   /product="peptide transporter 5"
FT                   /db_xref="GOA:Q9LFB8"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB8"
FT                   /protein_id="ANM69606.1"
FT                   /translation="MEDDKDIYTKDGTLDIHKKPANKNKTGTWKACRFILGTECCERLA
FT                   YYGMSTNLINYLEKQMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFV
FT                   VIYIAGMTLLTISASVPGLTPTCSGETCHATAGQTAITFIALYLIALGTGGIKPCVSSF
FT                   GADQFDDTDEKEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMA
FT                   IAVVFFFAGSNFYRLQKPGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSII
FT                   GSRKLEHTKILTFFDKAAVETESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGI
FT                   VFASVYSQMGTVFVLQGNTLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFAR
FT                   KYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQV
FT                   PQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVT
FT                   RSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWYTYKKTTGHAL"
     MEDDKDIYTK DGTLDIHKKP ANKNKTGTWK ACRFILGTEC CERLAYYGMS TNLINYLEKQ        60
     MNMENVSASK SVSNWSGTCY ATPLIGAFIA DAYLGRYWTI ASFVVIYIAG MTLLTISASV       120
     PGLTPTCSGE TCHATAGQTA ITFIALYLIA LGTGGIKPCV SSFGADQFDD TDEKEKESKS       180
     SFFNWFYFVI NVGAMIASSV LVWIQMNVGW GWGLGVPTVA MAIAVVFFFA GSNFYRLQKP       240
     GGSPLTRMLQ VIVASCRKSK VKIPEDESLL YENQDAESSI IGSRKLEHTK ILTFFDKAAV       300
     ETESDNKGAA KSSSWKLCTV TQVEELKALI RLLPIWATGI VFASVYSQMG TVFVLQGNTL       360
     DQHMGPNFKI PSASLSLFDT LSVLFWAPVY DKLIVPFARK YTGHERGFTQ LQRIGIGLVI       420
     SIFSMVSAGI LEVARLNYVQ THNLYNEETI PMTIFWQVPQ YFLVGCAEVF TFIGQLEFFY       480
     DQAPDAMRSL CSALSLTAIA FGNYLSTFLV TLVTKVTRSG GRPGWIAKNL NNGHLDYFFW       540
     LLAGLSFLNF LVYLWIAKWY TYKKTTGHAL                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page