(data stored in ACNUC13479 zone)

EMBL: CP002688.RAPTOR2

CP002688.RAPTOR2     Location/Qualifiers
FT   CDS             complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295716,
FT                   295792..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297927,298030..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300603,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /note="RAPTOR2 (RAPTOR2); FUNCTIONS IN: binding, nucleotide
FT                   binding; INVOLVED IN: cell growth; LOCATED IN: CUL4 RING
FT                   ubiquitin ligase complex; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 12 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Armadillo-like helical
FT                   (InterPro:IPR011989), WD40 repeat (InterPro:IPR001680),
FT                   Regulatory associated protein of TOR (InterPro:IPR004083),
FT                   WD40 repeat-like-containing domain (InterPro:IPR011046),
FT                   WD40-repeat-containing domain (InterPro:IPR017986),
FT                   WD40/YVTN repeat-like-containing domain
FT                   (InterPro:IPR015943), Armadillo-type fold
FT                   (InterPro:IPR016024), WD40 repeat, subgroup
FT                   (InterPro:IPR019781); BEST Arabidopsis thaliana protein
FT                   match is: HEAT repeat; WD domain, G-beta repeat protein
FT                   protein (TAIR:AT3G08850.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:Q9LZW9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES059290.1,INSD:ES008809.1,INSD:ES198247.1,
FT                   INSD:EH921215.1,INSD:EH800654.1,INSD:EG424616.1,
FT                   INSD:EL998946.1"
FT                   /protein_id="AED90389.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVF
FT                   TSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIA
FT                   WNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWD
FT                   MAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLL
FT                   SQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILA
FT                   LDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLI
FT                   AVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASENLIAGHTNL
FT                   LQVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRTE
FT                   VAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSLTRA
FT                   SPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPRPLD
FT                   NAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASASHTP
FT                   LAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDSGLA
FT                   DPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHIAKC
FT                   QHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGF
FT                   DNNDFPDKGISNLCLVNELDDSLLLVASCNVPTLSRASFAIRIWKDYATKGRQKLVTGF
FT                   SSIQGQKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTA
FT                   LSASQVHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIV
FT                   SASQAGDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGE
FT                   QLGIIKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     MALGDLMVSR LSQSSVTVVT NHLYDDDDNC ASSAHDDSRV SIIASPRVAS SSYENLSAAT        60
     SMAYLPQTLV LCDLRHDDAS DIVQPPRWRL KERMKTGCVA LVMCLHITVD PPDVIKISPC       120
     ARLECWIDPF SMFPPRRALE AIGQNLSIQY ERWLARARYK VELDPTKDDV RKLCLSCRKY       180
     AKTERVLFHY NGHGVPKPTP NGEIWVYNKN FTQYIPLPVS ELDSWLKTPT IYVFDCSAAR       240
     VILNAFAEGE SSGPPKDCIL LAACDVHETL PQSVEFPADV FTSCLTTPIN IALKWFCRRS       300
     LLKEFIDESL IDRIPGRQND RKTLLGELNW IFTAVTDTIA WNVLPRELFQ RLFRQDLLVA       360
     SLFRNFLLAE RIMRSGNCTP ISHPMLPPTH QHHMWDAWDM AAEICLSQLP QFFLDPNTEF       420
     QPSSFFTEQL TAFEVWLDHG SEHKKPPEQL PIVLQVLLSQ CHRYRALVLL GRFLDMGPWA       480
     VDLALSVGIY PCVVKLLQTT TIELRQILVF IWTKILALDK SCQVDLVKDR GHIYFIRFLD       540
     SSDAFPEQRA MAAFILAVIV DGYKRGQESC LEANLIAVCL GHLEATQLCD PPPEPLFLQW       600
     LCLCLGKLWE DYLEAQIMGR EANASENLIA GHTNLLQVRA AAVFALGTLL DVGFDSGKGV       660
     CDEEFDDDEN IVEDIIIKSL LDVVSDGSPL VRTEVAVALA RFAFGHKQHL KSVADSYWKP       720
     QNSLRTSLPS MAKFHDSGTS IVASSDMGSL TRASPDSQPV AREGRISSSL QEPFSGLMQG       780
     SPLADDSSLH SDVGIIHDGV SNGVVHQPRP LDNAIYSQSV LAMFTLAKDP SPRIASLGRR       840
     VLSVIGIEQI VAKPSKSNGR PGEAASASHT PLAGLVRSSS WFDMHTGHLP LTFRTPPVSP       900
     PQTSYLTGLR RVCSLELRPH LLGSPDSGLA DPILGVSGSE RSLLPQSTIY NWSCGHFSKP       960
     LLGGADANEE IAAQREEKKK FSLEHIAKCQ HSSISGLSNI PIANWDTKFE TGTKTALLHP      1020
     FSPIVVAADE NERIRVWNYE EATLLNGFDN NDFPDKGISN LCLVNELDDS LLLVASCNVP      1080
     TLSRASFAIR IWKDYATKGR QKLVTGFSSI QGQKPGASGL NAVVDWQQQS GYLYVSGESL      1140
     SIMVWDLDKE QLVKSMPFES GCSVTALSAS QVHGSQLAAG FADGSVRLYD VRTPDFLVCA      1200
     TRPHQRVEKV VGLSFQPGLD PAKIVSASQA GDIQFLDLRR PKETYLTIDA HRGSLTALGV      1260
     HRHAPIIASG SAKQLIKVFS LKGEQLGIIK YHTSFMGQQI GPVSCLAFHP YQMLLAAGAA      1320
     GSFVSLYTHH NTQLPR                                                      1336
//

If you have problems or comments...

PBIL Back to PBIL home page