(data stored in ACNUC13479 zone)

EMBL: CP002688.RSR4

CP002688.RSR4        Location/Qualifiers
FT   CDS             complement(172576..173505)
FT                   /codon_start=1
FT                   /gene="RSR4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PYRIDOXINE BIOSYNTHESIS
FT                   1.3"
FT                   /gene_synonym="ATPDX1"
FT                   /gene_synonym="ATPDX1.3"
FT                   /gene_synonym="PDX1"
FT                   /gene_synonym="PDX1.3"
FT                   /gene_synonym="PYRIDOXINE BIOSYNTHESIS 1.3"
FT                   /gene_synonym="REDUCED SUGAR RESPONSE 4"
FT                   /gene_synonym="T10O8.120"
FT                   /gene_synonym="T10O8_120"
FT                   /locus_tag="AT5G01410"
FT                   /product="Aldolase-type TIM barrel family protein"
FT                   /db_xref="GOA:Q8L940"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:5K2Z"
FT                   /db_xref="PDB:5K3V"
FT                   /db_xref="PDB:5LNR"
FT                   /db_xref="PDB:5LNS"
FT                   /db_xref="PDB:5LNU"
FT                   /db_xref="PDB:5LNV"
FT                   /db_xref="PDB:5LNW"
FT                   /db_xref="PDB:6HX3"
FT                   /db_xref="PDB:6HXG"
FT                   /db_xref="PDB:6HYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L940"
FT                   /protein_id="ANM69812.1"
FT                   /translation="MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAE
FT                   QARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFV
FT                   EAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIR
FT                   TKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLP
FT                   VVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLV
FT                   EVSCGLGEAMVGINLNDEKVERFANRSE"
     MEGTGVVAVY GNGAITEAKK SPFSVKVGLA QMLRGGVIMD VVNAEQARIA EEAGACAVMA        60
     LERVPADIRA QGGVARMSDP QMIKEIKQAV TIPVMAKARI GHFVEAQILE AIGIDYIDES       120
     EVLTLADEDH HINKHNFRIP FVCGCRNLGE ALRRIREGAA MIRTKGEAGT GNIIEAVRHV       180
     RSVNGDIRVL RNMDDDEVFT FAKKLAAPYD LVMQTKQLGR LPVVQFAAGG VATPADAALM       240
     MQLGCDGVFV GSGIFKSGDP ARRARAIVQA VTHYSDPEML VEVSCGLGEA MVGINLNDEK       300
     VERFANRSE                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page