(data stored in ACNUC13479 zone)

EMBL: CP002688.RUS5

CP002688.RUS5        Location/Qualifiers
FT   CDS             join(201702..201856,201940..202002,202088..202245,
FT                   202390..202490,202609..202679,202773..202819,
FT                   202900..202978,203082..203154,203269..203358,
FT                   203458..203517,203641..203754,203839..203899,
FT                   203969..204087,204183..204275,204906..205151)
FT                   /codon_start=1
FT                   /gene="RUS5"
FT                   /gene_synonym="F7A7.30"
FT                   /gene_synonym="F7A7_30"
FT                   /gene_synonym="ROOT UV-B SENSITIVE 5"
FT                   /locus_tag="AT5G01510"
FT                   /product="root UVB sensitive protein (Protein of unknown
FT                   function, DUF647)"
FT                   /note="ROOT UV-B SENSITIVE 5 (RUS5); CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF647
FT                   (InterPro:IPR006968); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function, DUF647
FT                   (TAIR:AT3G45890.1); Has 426 Blast hits to 424 proteins in
FT                   125 species: Archae - 0; Bacteria - 2; Metazoa - 111; Fungi
FT                   - 69; Plants - 183; Viruses - 0; Other Eukaryotes - 61
FT                   (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IDH3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES069503.1,INSD:ES057259.1,INSD:BP790823.1,
FT                   INSD:EL076072.1,INSD:BP793599.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT050411.1,INSD:BX829823.1,INSD:BX830511.1"
FT                   /protein_id="AED90354.1"
FT                   /translation="MYCTLRFPLPLHIPQTRTMTSCQPKRRRVEHLRCSAQPSSIREDD
FT                   EDADDRRVGVERRISIVVERYGNGTSKRYFLDDDDSPLQGILEERETKPDNNSQSSNSS
FT                   ETNILWLPDVVRDFVFPSGFPGSVSDDYLDYMLWQFPTNITGWICNVLVTSSLLKAVGV
FT                   GSFSGTSAAATAAASAAAIRWVSKDGIGALGRLLIGGRFGSLFDDDPKQWRMYADFIGS
FT                   AGSFFDLATQLYPSQFLLLASTGNLAKAVARGLRDPSFRVIQNHFAISGNLGEVAAKEE
FT                   VWEVAAQLIGLGFGILIIDTPGLVKSFPFVLLTWTSIRLVHLWLRYQSLAVLQFNTVNL
FT                   KRARIIVESHVVHSVVPGYVDCNKRENILLWQRFMKPRIIFGVSLEELSGLEKSVSKVK
FT                   ALLKMYTKEKYILTLNKLNKDTEFSVSFKVNATSRDVLRCLWQAYWLEENMEESFKDKD
FT                   SVFHWLKQSLSEMDNKFDDFLFKLDTAGWNLRESNLKVPNQVLIDQESIPF"
     MYCTLRFPLP LHIPQTRTMT SCQPKRRRVE HLRCSAQPSS IREDDEDADD RRVGVERRIS        60
     IVVERYGNGT SKRYFLDDDD SPLQGILEER ETKPDNNSQS SNSSETNILW LPDVVRDFVF       120
     PSGFPGSVSD DYLDYMLWQF PTNITGWICN VLVTSSLLKA VGVGSFSGTS AAATAAASAA       180
     AIRWVSKDGI GALGRLLIGG RFGSLFDDDP KQWRMYADFI GSAGSFFDLA TQLYPSQFLL       240
     LASTGNLAKA VARGLRDPSF RVIQNHFAIS GNLGEVAAKE EVWEVAAQLI GLGFGILIID       300
     TPGLVKSFPF VLLTWTSIRL VHLWLRYQSL AVLQFNTVNL KRARIIVESH VVHSVVPGYV       360
     DCNKRENILL WQRFMKPRII FGVSLEELSG LEKSVSKVKA LLKMYTKEKY ILTLNKLNKD       420
     TEFSVSFKVN ATSRDVLRCL WQAYWLEENM EESFKDKDSV FHWLKQSLSE MDNKFDDFLF       480
     KLDTAGWNLR ESNLKVPNQV LIDQESIPF                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page