(data stored in ACNUC13479 zone)

EMBL: CP002688.SAUR21

CP002688.SAUR21      Location/Qualifiers
FT   CDS             320983..323007
FT                   /codon_start=1
FT                   /gene="SAUR21"
FT                   /gene_synonym="T20L15.100"
FT                   /gene_synonym="T20L15_100"
FT                   /gene_synonym="SMALL AUXIN UP RNA 21"
FT                   /locus_tag="AT5G01830"
FT                   /product="ARM repeat superfamily protein"
FT                   /note="ARM repeat superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity, binding; INVOLVED IN:
FT                   response to chitin; LOCATED IN: ubiquitin ligase complex;
FT                   EXPRESSED IN: root; CONTAINS InterPro DOMAIN/s: U box
FT                   domain (InterPro:IPR003613), Armadillo-like helical
FT                   (InterPro:IPR011989), Armadillo (InterPro:IPR000225),
FT                   Armadillo-type fold (InterPro:IPR016024); BEST Arabidopsis
FT                   thaliana protein match is: plant U-box 17
FT                   (TAIR:AT1G29340.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW3"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP620856.1,INSD:ES111102.1,INSD:BP608621.1,
FT                   INSD:T76464.1,INSD:AU036576.1,INSD:BP798947.1,
FT                   INSD:AU237885.1,INSD:BP610001.1,INSD:AA394623.1,
FT                   INSD:AU228988.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015725.1,INSD:BT015367.1,INSD:AK229397.1"
FT                   /protein_id="AED90398.1"
FT                   /translation="MAVTLDSPSPARKRRPLVVGSFESPKLSSDTKLTRSLFLASHEIS
FT                   SMQPLPFILRRNSLSLIRKVKILASVFDELLLPRSQLVVYSQSAHLCFEEMQIVMQRIK
FT                   SLIDDCSRVSKLWLLLQIDIVAFNFHELVTDLSTVLDILPLHDFDLSDDAQDLISLLTK
FT                   QCSDSVQFVDARDVALRRKVTDTIAGIKHQISPDHSTLIKIFNDLGLSDSASLTDEIQR
FT                   LEDEIQDQIDDRSKSAAASLIGLVRYSKCVLYGPSTPAPDFRRHQSLSDANIPADFRCP
FT                   ITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQVLKHTSLVPNRALKNLIVLW
FT                   CRDQKIPFELYGDGGGEPAPCKEAVEFTKMMVSFLIEKLSVADSNGVVFELRALAKSDT
FT                   VARACIAEAGAIPKLVRYLATECPSLQINAVTTILNLSILEQNKTRIMETDGALNGVIE
FT                   VLRSGATWEAKANAAATLFSLAGVSAYRRRLGRKARVVSGLVDLAKQGPTSSKRDALVA
FT                   ILNLVAERENVGRFVEAGVMGAAGDAFQELPEEAVAVVEAVVRRGGLMAVSAAFSLIRL
FT                   LGEVMREGADTTRESAAATLVTMCRKGGSELVAEMAAIPGIERVIWEMIGAGTARGGRK
FT                   AASLMRYLRRWAAGDTHNTAAETQSIVVPTPSRIFSPVL"
     MAVTLDSPSP ARKRRPLVVG SFESPKLSSD TKLTRSLFLA SHEISSMQPL PFILRRNSLS        60
     LIRKVKILAS VFDELLLPRS QLVVYSQSAH LCFEEMQIVM QRIKSLIDDC SRVSKLWLLL       120
     QIDIVAFNFH ELVTDLSTVL DILPLHDFDL SDDAQDLISL LTKQCSDSVQ FVDARDVALR       180
     RKVTDTIAGI KHQISPDHST LIKIFNDLGL SDSASLTDEI QRLEDEIQDQ IDDRSKSAAA       240
     SLIGLVRYSK CVLYGPSTPA PDFRRHQSLS DANIPADFRC PITLELMRDP VVVATGQTYD       300
     RESIDLWIQS GHNTCPKTGQ VLKHTSLVPN RALKNLIVLW CRDQKIPFEL YGDGGGEPAP       360
     CKEAVEFTKM MVSFLIEKLS VADSNGVVFE LRALAKSDTV ARACIAEAGA IPKLVRYLAT       420
     ECPSLQINAV TTILNLSILE QNKTRIMETD GALNGVIEVL RSGATWEAKA NAAATLFSLA       480
     GVSAYRRRLG RKARVVSGLV DLAKQGPTSS KRDALVAILN LVAERENVGR FVEAGVMGAA       540
     GDAFQELPEE AVAVVEAVVR RGGLMAVSAA FSLIRLLGEV MREGADTTRE SAAATLVTMC       600
     RKGGSELVAE MAAIPGIERV IWEMIGAGTA RGGRKAASLM RYLRRWAAGD THNTAAETQS       660
     IVVPTPSRIF SPVL                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page