(data stored in ACNUC13479 zone)

EMBL: CP002688.SCAR4

CP002688.SCAR4       Location/Qualifiers
FT   CDS             complement(join(273019..273069,273192..273305,
FT                   273389..273475,273554..276179,276292..276353,
FT                   276490..276619,276703..276826,276918..277081,
FT                   277407..277561))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="GOA:Q5XPJ6"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XPJ6"
FT                   /protein_id="ANM68918.1"
FT                   /translation="MALTRYQIRNEYGLADKELYQSADKEDPEALLEAASMAGLVGVLR
FT                   QLGDLSEFAAEVFHCLHEQLMTTAARGHGLAMRLQHLEADFPSVEIPILSQTDHSTFFY
FT                   EPGLEWHSDLQTKEDLISPRNLPRCIMDSYEECHGPPQLFLLDKFDVAGSGSCLKRYSD
FT                   PSLLKTHTTSAVVATSKLGKDKRLRQSKKKGSHTTIKETPEDSRTSHAKLHQLFFLEHV
FT                   ENGHRNPEFHVKLKRRQLNGPPINSSSGASYMEKFLKNSSPYCERVHGTMDQSSPAMET
FT                   EVTVCSEQEDLPIPSLVYSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVV
FT                   CLESSSSVNLCCKTNNDADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQ
FT                   TEVLTQFSNVLRHSPEEGESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDS
FT                   AGMGTLEILQTPFSLSCYESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISP
FT                   ETHLLKVTQVPQDAYEGGTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALES
FT                   EDISSEAGHFIPDTKKSLNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKE
FT                   DETNSQDGSSMNPAQSKHISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANP
FT                   DLAEISSYSGQEDPQTMSIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQ
FT                   KELETISDPQESLLGTEECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSV
FT                   GVQSSPLDVFPSSITEIEALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESIL
FT                   PLSTSLHETPQANPEITPPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQ
FT                   NGSVQANEAQYPSEVSVTDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLN
FT                   RTPEDSFSLAESAQGLEADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKP
FT                   GQTKFRQTLRDNNSYNQNQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDEND
FT                   SLLEIIRSKSFNLRPADASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSD
FT                   SWSE"
     MALTRYQIRN EYGLADKELY QSADKEDPEA LLEAASMAGL VGVLRQLGDL SEFAAEVFHC        60
     LHEQLMTTAA RGHGLAMRLQ HLEADFPSVE IPILSQTDHS TFFYEPGLEW HSDLQTKEDL       120
     ISPRNLPRCI MDSYEECHGP PQLFLLDKFD VAGSGSCLKR YSDPSLLKTH TTSAVVATSK       180
     LGKDKRLRQS KKKGSHTTIK ETPEDSRTSH AKLHQLFFLE HVENGHRNPE FHVKLKRRQL       240
     NGPPINSSSG ASYMEKFLKN SSPYCERVHG TMDQSSPAME TEVTVCSEQE DLPIPSLVYS       300
     NSGGTRKYNE MEIESIAGHE ILEIPFVPHE ITVNEKSPVV CLESSSSVNL CCKTNNDADS       360
     PASTESEVKE AGSDDKAGCD HGFPGFGQPQ ICTNAEVNQT EVLTQFSNVL RHSPEEGESS       420
     LLCTDIQRAS PESKPHKAEE AAVDLDESFS QMTPDIDSAG MGTLEILQTP FSLSCYESPA       480
     NLPEDSGSHL ELQSNKANAE ACEVFEVRRD PMLNISPETH LLKVTQVPQD AYEGGTNDVH       540
     SQHVFSVETA SEISVSALVE DQFSSITNQE IEALESEDIS SEAGHFIPDT KKSLNETSVA       600
     LESDFLLPNH YISTFDNFED LSLSADAQDY AAPKEDETNS QDGSSMNPAQ SKHISTSEIS       660
     SENGTLMSDT PRDLHTGYGS LSASSCLEDG LANPDLAEIS SYSGQEDPQT MSIVSDDSSD       720
     PEVPIPDGTC FAGDVDHDNQ TGLNNKAIET VPQKELETIS DPQESLLGTE ECLSSEYCLQ       780
     IQNQRQESPS ETGSANSRTS SDESPPTQNG SVGVQSSPLD VFPSSITEIE ALHAPYQEIF       840
     TSLNDHISES VLSKGLTDEE DFLNVSPESI LPLSTSLHET PQANPEITPP LPPLPPTQWW       900
     MGKLVESTEM PSLAGSGNNS FNIQRDENTQ NGSVQANEAQ YPSEVSVTDG ENHNFHIYTE       960
     ESKATEEQSP SGVNGTSDTY MESKHKCLNR TPEDSFSLAE SAQGLEADWR TEAMALEWFS      1020
     QNLREHNNPH PAKLEEEEPQ VDHPLEKPGQ TKFRQTLRDN NSYNQNQKAG KLKRDEDTLV      1080
     IGIDRSMLRK VSEGNRTHVG ARVDENDSLL EIIRSKSFNL RPADASGRPN FQVAVPKTNL      1140
     KVAAILEKAN TLRQAMAGSD DEHDSDSWSE                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page