(data stored in ACNUC13479 zone)

EMBL: CP002688.SQD2

CP002688.SQD2        Location/Qualifiers
FT   CDS             complement(join(86907..87182,87414..87630,87724..87780,
FT                   87858..87935,88027..88114,88204..88287,88388..88443,
FT                   88525..88598,88701..88818,88892..88962,89103..89169,
FT                   89539..89885))
FT                   /codon_start=1
FT                   /gene="SQD2"
FT                   /gene_synonym="F7J8.200"
FT                   /gene_synonym="F7J8_200"
FT                   /gene_synonym="SULFOLIPID SYNTHASE"
FT                   /gene_synonym="sulfoquinovosyldiacylglycerol 2"
FT                   /locus_tag="AT5G01220"
FT                   /product="sulfoquinovosyldiacylglycerol 2"
FT                   /note="sulfoquinovosyldiacylglycerol 2 (SQD2); FUNCTIONS
FT                   IN: UDP-glycosyltransferase activity,
FT                   UDP-sulfoquinovose:DAG sulfoquinovosyltransferase activity,
FT                   transferase activity, transferring glycosyl groups;
FT                   INVOLVED IN: cellular response to phosphate starvation,
FT                   sulfolipid biosynthetic process, glycolipid biosynthetic
FT                   process; LOCATED IN: chloroplast, chloroplast envelope;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Glycosyl
FT                   transferase, group 1 (InterPro:IPR001296); BEST Arabidopsis
FT                   thaliana protein match is: UDP-Glycosyltransferase
FT                   superfamily protein (TAIR:AT5G59070.1); Has 35941 Blast
FT                   hits to 35876 proteins in 3155 species: Archae - 1250;
FT                   Bacteria - 26211; Metazoa - 142; Fungi - 236; Plants -
FT                   1690; Viruses - 2; Other Eukaryotes - 6410 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01220"
FT                   /db_xref="GOA:Q8S4F6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S4F6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES088950.1,INSD:EL123674.1,INSD:ES100266.1,
FT                   INSD:AI999595.1,INSD:EG496269.1,INSD:EL073620.1,
FT                   INSD:EL275023.1,INSD:BP805010.1,INSD:BP847142.1,
FT                   INSD:ES113947.1,INSD:AV540845.1,INSD:EG496268.1,
FT                   INSD:EH907656.1,INSD:EG451757.1,INSD:AV784670.1,
FT                   INSD:EL122192.1,INSD:ES184102.1,INSD:EG451765.1,
FT                   INSD:ES114807.1,INSD:EL277212.1,INSD:BP791225.1,
FT                   INSD:EL203802.1,INSD:EG451746.1,INSD:EL172067.1,
FT                   INSD:EG473715.1,INSD:CD530520.1,INSD:AV811076.1,
FT                   INSD:EG451747.1,INSD:EL022787.1,INSD:EL252269.1,
FT                   INSD:EL019868.1,INSD:EL169646.1,INSD:AV823662.1,
FT                   INSD:BG459186.1,INSD:EG451763.1,INSD:DR353265.1,
FT                   INSD:AA651177.1,INSD:EL264514.1,INSD:EL027254.1,
FT                   INSD:ES059394.1,INSD:CD532372.1,INSD:EH796489.1,
FT                   INSD:EG451758.1,INSD:CB259028.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF454354.1,INSD:BT005796.1,INSD:AY045961.2,
FT                   INSD:BX830044.1"
FT                   /protein_id="AED90311.1"
FT                   /translation="MTTLSSINLSIPPHLLPSTTNTCSSSSATSCSPPRSSSFVLHSPL
FT                   SFGHRRLPISKKSKLRFCGVITKEAVSGSNDMTITQVREDDESEIDAPLLDPESLSKPR
FT                   RIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSRSF
FT                   PCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPGVMVFGALAIAKMLSVPIVMSYHT
FT                   HVPVYIPRYTFSWLVKPMWSIIRFLHRAADLTLVPSAAIGKDLIAAGATAANQLRLWNK
FT                   GVDSESFNPRFRSQEMRIRLSNGEPEKPLVIHVGRIGVEKSLELLKSVMDKLPEARIAF
FT                   IGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGDVFVMPSESETLGLVVLEAMSS
FT                   GLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAARE
FT                   ETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWLIKRLFPVPEGNV"
     MTTLSSINLS IPPHLLPSTT NTCSSSSATS CSPPRSSSFV LHSPLSFGHR RLPISKKSKL        60
     RFCGVITKEA VSGSNDMTIT QVREDDESEI DAPLLDPESL SKPRRIALFV EPSPFAYVSG       120
     YKNRFQNFIR YLREMGDEVI VVTTHEGVPE EFYGARVIGS RSFPCPYYQK VPLSLALSPR       180
     IISEIARFKP DIIHASSPGV MVFGALAIAK MLSVPIVMSY HTHVPVYIPR YTFSWLVKPM       240
     WSIIRFLHRA ADLTLVPSAA IGKDLIAAGA TAANQLRLWN KGVDSESFNP RFRSQEMRIR       300
     LSNGEPEKPL VIHVGRIGVE KSLELLKSVM DKLPEARIAF IGDGPYKEDL EKLFTGMPAV       360
     FTGTLQGDEL SQAYASGDVF VMPSESETLG LVVLEAMSSG LPVVAARAGG IPDIIPEDQE       420
     GKTGFLFNPG DVEDCVTKLR TLLHDRETRE IIGKAAREET EKYDWRAATT KIRNEQYSAA       480
     IWFWRKKKVH VLGPINWLIK RLFPVPEGNV                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page