(data stored in ACNUC13479 zone)

EMBL: CP002688.SR1

CP002688.SR1         Location/Qualifiers
FT   CDS             complement(313423..314751)
FT                   /codon_start=1
FT                   /gene="SR1"
FT                   /gene_synonym="ATCIPK14"
FT                   /gene_synonym="ATSR1"
FT                   /gene_synonym="CBL-INTERACTING PROTEIN KINASE 14"
FT                   /gene_synonym="CIPK14"
FT                   /gene_synonym="serine/threonine protein kinase 1"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 1"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.15"
FT                   /gene_synonym="SnRK3.15"
FT                   /gene_synonym="T20L15.90"
FT                   /gene_synonym="T20L15_90"
FT                   /gene_synonym="PKS24"
FT                   /gene_synonym="SOS2-like protein kinase 24"
FT                   /locus_tag="AT5G01820"
FT                   /product="serine/threonine protein kinase 1"
FT                   /note="serine/threonine protein kinase 1 (SR1); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, protein
FT                   kinase activity, kinase activity, ATP binding; INVOLVED IN:
FT                   signal transduction, protein amino acid phosphorylation;
FT                   LOCATED IN: vacuole; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: SOS3-interacting protein 4
FT                   (TAIR:AT2G30360.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="PDB:2ZFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG508678.1,INSD:AV810130.1,INSD:BP812529.1,
FT                   INSD:CB259689.1,INSD:ES129059.1,INSD:BP834022.1,
FT                   INSD:EH854951.1,INSD:ES014287.1,INSD:DR339470.1,
FT                   INSD:H37465.1,INSD:EL341569.1,INSD:CB257243.1,
FT                   INSD:CD529105.1,INSD:CD530616.1,INSD:EH848117.1,
FT                   INSD:BE527250.1,INSD:AV808027.1,INSD:T45283.1,
FT                   INSD:BP647565.1,INSD:CB260079.1,INSD:BP829028.1,
FT                   INSD:CB259979.1,INSD:ES134390.1,INSD:ES137442.1,
FT                   INSD:BE522098.1,INSD:ES142224.1,INSD:AV566674.1,
FT                   INSD:AV818150.1,INSD:ES179268.1,INSD:CB260648.1,
FT                   INSD:BE522099.1,INSD:BP834394.1,INSD:BP829967.1,
FT                   INSD:W43158.1,INSD:BP861006.1,INSD:EL205963.1,
FT                   INSD:EL016491.1,INSD:ES062448.1,INSD:CK118220.1,
FT                   INSD:CB255865.1,INSD:EL999478.1,INSD:AV830729.1,
FT                   INSD:ES086863.1,INSD:DR339471.1,INSD:CF773405.1,
FT                   INSD:EL994646.1,INSD:ES167392.1,INSD:H36240.1,
FT                   INSD:BP827495.1,INSD:AV812815.1,INSD:BP646669.1,
FT                   INSD:EL011114.1,INSD:AV558457.1,INSD:BP561730.2,
FT                   INSD:ES010780.1,INSD:ES134325.1,INSD:EL180254.1,
FT                   INSD:BP777505.1,INSD:N96318.1,INSD:EH858888.1,
FT                   INSD:EL095292.1,INSD:EG508668.1,INSD:AV809753.1,
FT                   INSD:CB255566.1,INSD:CB255570.1,INSD:AV439652.1,
FT                   INSD:BP648276.1,INSD:CB260946.1,INSD:BP847557.1,
FT                   INSD:AV831909.1,INSD:EG508679.1,INSD:ES052278.1,
FT                   INSD:EL174264.1,INSD:EG428947.1,INSD:EG428948.1,
FT                   INSD:ES043670.1,INSD:BP779716.1,INSD:ES170934.1,
FT                   INSD:AV521433.1,INSD:DR365707.1,INSD:AV798221.1,
FT                   INSD:AV553225.1,INSD:ES175977.1,INSD:ES157234.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB035147.1,INSD:BX829749.1,INSD:BX830122.1,
FT                   INSD:AF360189.1,INSD:BX830723.1,INSD:BT015592.1,
FT                   INSD:AF295669.1,INSD:AY142684.1,INSD:BX829819.1"
FT                   /protein_id="AED90397.1"
FT                   /translation="MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATG
FT                   QSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKG
FT                   GELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDF
FT                   GLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPF
FT                   NDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYD
FT                   DRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERF
FT                   VSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEV
FT                   RKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS"
     MVDSDPVEFP PENRRGQLFG KYEVGKLVGC GAFAKVYHGR STATGQSVAI KVVSKQRLQK        60
     GGLNGNIQRE IAIMHRLRHP SIVRLFEVLA TKSKIFFVME FAKGGELFAK VSKGRFCEDL       120
     SRRYFQQLIS AVGYCHSRGI FHRDLKPENL LLDEKLDLKI SDFGLSALTD QIRPDGLLHT       180
     LCGTPAYVAP EVLAKKGYDG AKIDIWSCGI ILFVLNAGYL PFNDHNLMVM YRKIYKGEFR       240
     IPKWTSPDLR RLLTRLLDTN PQTRITIEEI IHDPWFKQGY DDRMSKFHLE DSDMKLPADE       300
     TDSEMGARRM NAFDIISGSP GFNLSGLFGD ARKYDRVERF VSAWTAERVV ERLEEIVSAE       360
     NLTVAKKETW GMKIEGQKGN FAMVVEINQL TDELVMIEVR KRQRAAASGR DLWTDTLRPF       420
     FVELVHESDQ TDPEPTQVHT TS                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page