(data stored in ACNUC13479 zone)

EMBL: CP002688.TAAC

CP002688.TAAC        Location/Qualifiers
FT   CDS             join(199017..199448,199804..199860,199958..200020,
FT                   200113..200169,200280..200363,200441..200509,
FT                   200586..200698,200783..200952,201036..201114,
FT                   201206..201329)
FT                   /codon_start=1
FT                   /gene="TAAC"
FT                   /gene_synonym="F7A7.20"
FT                   /gene_synonym="F7A7_20"
FT                   /gene_synonym="thylakoid ATP/ADP carrier"
FT                   /locus_tag="AT5G01500"
FT                   /product="thylakoid ATP/ADP carrier"
FT                   /note="thylakoid ATP/ADP carrier (TAAC); FUNCTIONS IN:
FT                   binding, transporter activity, ATP transmembrane
FT                   transporter activity; INVOLVED IN: photosystem II repair,
FT                   transport, photoprotection; LOCATED IN: in 7 components;
FT                   EXPRESSED IN: 27 plant structures; EXPRESSED DURING: 14
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Mitochondrial
FT                   carrier protein (InterPro:IPR002067), Mitochondrial
FT                   substrate carrier (InterPro:IPR001993), Mitochondrial
FT                   substrate/solute carrier (InterPro:IPR018108); BEST
FT                   Arabidopsis thaliana protein match is: Mitochondrial
FT                   substrate carrier family protein (TAIR:AT3G51870.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M024"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M024"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR381636.1,INSD:AV544656.1,INSD:AV526741.1,
FT                   INSD:AV784181.1,INSD:ES104469.1,INSD:AV823248.1,
FT                   INSD:DR348651.1,INSD:DR348650.1,INSD:BP785487.1,
FT                   INSD:BU634615.1,INSD:EL293347.1,INSD:ES048037.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT006336.1,INSD:BX831380.1,INSD:BX830301.1,
FT                   INSD:AY074566.1,INSD:AY086408.1,INSD:BX830063.1"
FT                   /protein_id="AED90353.1"
FT                   /translation="MGEEKSLLQFRSFPSLKTSDFALTEEPSWRLENNVSSNRRRGNKR
FT                   SGGVFTNFASLSVAIRRDRRESTFNGRNGGGGGAFASVSVVIPKEEDEFAPTSAQLLKN
FT                   PIALLSIVPKDAALFFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIE
FT                   AITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGRLGAG
FT                   ACAGMTSTLITYPLDVLRLRLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAP
FT                   YIAINFCVFDLVKKSLPEKYQQKTQSSLLTAVVAAAIATGTCYPLDTIRRQMQLKGTPY
FT                   KSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIVKKLIAASEKEIQRIA
FT                   DDNRKKASPNTIDEQT"
     MGEEKSLLQF RSFPSLKTSD FALTEEPSWR LENNVSSNRR RGNKRSGGVF TNFASLSVAI        60
     RRDRRESTFN GRNGGGGGAF ASVSVVIPKE EDEFAPTSAQ LLKNPIALLS IVPKDAALFF       120
     AGAFAGAAAK SVTAPLDRIK LLMQTHGVRA GQQSAKKAIG FIEAITLIGK EEGIKGYWKG       180
     NLPQVIRIVP YSAVQLFAYE TYKKLFRGKD GQLSVLGRLG AGACAGMTST LITYPLDVLR       240
     LRLAVEPGYR TMSQVALNML REEGVASFYN GLGPSLLSIA PYIAINFCVF DLVKKSLPEK       300
     YQQKTQSSLL TAVVAAAIAT GTCYPLDTIR RQMQLKGTPY KSVLDAFSGI IAREGVVGLY       360
     RGFVPNALKS MPNSSIKLTT FDIVKKLIAA SEKEIQRIAD DNRKKASPNT IDEQT            415
//

If you have problems or comments...

PBIL Back to PBIL home page