(data stored in ACNUC13479 zone)

EMBL: CP002688.TBL3

CP002688.TBL3        Location/Qualifiers
FT   CDS             complement(join(147608..147941,148018..148376,
FT                   148502..148673,148764..149004,149118..149316))
FT                   /codon_start=1
FT                   /gene="TBL3"
FT                   /gene_synonym="T10O8.70"
FT                   /gene_synonym="T10O8_70"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 3"
FT                   /locus_tag="AT5G01360"
FT                   /product="trichome birefringence-like protein (DUF828)"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 3 (TBL3); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF231,
FT                   plant (InterPro:IPR004253); BEST Arabidopsis thaliana
FT                   protein match is: Plant protein of unknown function
FT                   (DUF828) (TAIR:AT3G55990.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01360"
FT                   /db_xref="GOA:Q8LED3"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LED3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235894.1,INSD:DR249278.1,INSD:AU226666.1,
FT                   INSD:DR381102.1,INSD:BP566284.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085483.1,INSD:AK227978.1"
FT                   /protein_id="AED90331.1"
FT                   /translation="MSFLIPNRGVGGTKIPLSIIVLVLCGFMFFILLYTERISLLSSSS
FT                   SSSSSFFKLKSCPRKDVSSKPKEKIRKERSEILEVLDDRFEFDPEECNVAAGKWVYNSS
FT                   IEPLYTDRSCPYIDRQFSCMKNGQPETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLL
FT                   FVGDSLQRSQWESFVCLVESIIPEGEKSMKRSQKYFVFKAKEYNATIEFYWAPYIVESN
FT                   TDIPVISDPKKRIVKVDSVKDRAKFWEGADILVFNTYVWWMSGLRMKALWGSFGNGESG
FT                   AEALDTQVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWGKPNGTKCFNET
FT                   KPIKDKKFWGTGSNKQMMKVVSSVIKHMTTHVTVINITQLSEYRIDAHTSVYTETGGKI
FT                   LTAEQRADPMHHADCIHWCLPGLPDTWNRILLAHL"
     MSFLIPNRGV GGTKIPLSII VLVLCGFMFF ILLYTERISL LSSSSSSSSS FFKLKSCPRK        60
     DVSSKPKEKI RKERSEILEV LDDRFEFDPE ECNVAAGKWV YNSSIEPLYT DRSCPYIDRQ       120
     FSCMKNGQPE TDYLRWEWQP DDCTIPRFSP KLAMNKLRGK RLLFVGDSLQ RSQWESFVCL       180
     VESIIPEGEK SMKRSQKYFV FKAKEYNATI EFYWAPYIVE SNTDIPVISD PKKRIVKVDS       240
     VKDRAKFWEG ADILVFNTYV WWMSGLRMKA LWGSFGNGES GAEALDTQVA YRLGLKTWAN       300
     WVDSTVDPNK TRVFFTTMSP THTRSADWGK PNGTKCFNET KPIKDKKFWG TGSNKQMMKV       360
     VSSVIKHMTT HVTVINITQL SEYRIDAHTS VYTETGGKIL TAEQRADPMH HADCIHWCLP       420
     GLPDTWNRIL LAHL                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page