(data stored in ACNUC13479 zone)

EMBL: CP002688.TBL35

CP002688.TBL35       Location/Qualifiers
FT   CDS             join(232882..233092,233183..233492,233691..233862,
FT                   233964..234160,234242..234394,234491..234821)
FT                   /codon_start=1
FT                   /gene="TBL35"
FT                   /gene_synonym="F7A7.140"
FT                   /gene_synonym="F7A7_140"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /locus_tag="AT5G01620"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 35 (TBL35); LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF231, plant
FT                   (InterPro:IPR004253); BEST Arabidopsis thaliana protein
FT                   match is: TRICHOME BIREFRINGENCE-LIKE 34
FT                   (TAIR:AT2G38320.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01620"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01620.3"
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /protein_id="AED90368.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHGFCFEKNAEVLDRFSKCNSTKEYSGKKIGWVDPF
FT                   EDHPGQVTKEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHW
FT                   RWQPHACNLKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPN
FT                   AHLTIFRAEDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADIL
FT                   IFNTYLWWRQDSVKLRWSSEEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFV
FT                   TMSPTHQWSREWNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVI
FT                   NITQLSEYRKDGHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
     MSQRWSRKKS RLPLAGLLFI LVVTFMILFN ERSIQQIHHH AASHTQNLRE PSTFDFVKPN        60
     VPRINYLGAH GFCFEKNAEV LDRFSKCNST KEYSGKKIGW VDPFEDHPGQ VTKEEQKCDV       120
     FSGKWVFDNS SSYPLHKESQ CPYMSDQLAC QKHGRKDLEY QHWRWQPHAC NLKRWNAIEM       180
     WEKLRGKRLM FVGDSLNRGQ WISMVCLLQS VIPRDKQSMS PNAHLTIFRA EDYNATVEFL       240
     WAPLLVESNS DDPVNHRLSE RIIRPDSVLK HASKWQHADI LIFNTYLWWR QDSVKLRWSS       300
     EEKGSCEEVK SAEGMEMAMD SWGDWVANNV DPNKKRVFFV TMSPTHQWSR EWNPGSEGNC       360
     YGEKKPIEEE SYWGSGSDIP TMRMVKRVLE RLGPKVSVIN ITQLSEYRKD GHPSVYRKFW       420
     EPLNEDRLKN PASYSDCTHW CVPGVPDVWN QLLFHFL                                457
//

If you have problems or comments...

PBIL Back to PBIL home page