(data stored in ACNUC13479 zone)

EMBL: CP002688.WRKY62

CP002688.WRKY62      Location/Qualifiers
FT   CDS             complement(join(351136..351661,351748..352013))
FT                   /codon_start=1
FT                   /gene="WRKY62"
FT                   /gene_synonym="ARABIDOPSIS THALIANA WRKY DNA-BINDING
FT                   PROTEIN 62"
FT                   /gene_synonym="ATWRKY62"
FT                   /gene_synonym="T20L15.170"
FT                   /gene_synonym="T20L15_170"
FT                   /gene_synonym="WRKY DNA-binding protein 62"
FT                   /locus_tag="AT5G01900"
FT                   /product="WRKY DNA-binding protein 62"
FT                   /note="WRKY DNA-binding protein 62 (WRKY62); CONTAINS
FT                   InterPro DOMAIN/s: DNA-binding WRKY (InterPro:IPR003657);
FT                   BEST Arabidopsis thaliana protein match is: WRKY
FT                   DNA-binding protein 38 (TAIR:AT5G22570.1); Has 3146 Blast
FT                   hits to 2717 proteins in 131 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 0; Fungi - 0; Plants - 3132; Viruses - 0;
FT                   Other Eukaryotes - 14 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV6"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB185474.1,INSD:CB185507.1,INSD:BE662848.1,
FT                   INSD:CB185477.1,INSD:CB185574.1,INSD:CB185517.1,
FT                   INSD:CB185503.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF224700.1"
FT                   /protein_id="AED90407.1"
FT                   /translation="MNSCQQKAMEKLLHGHGCANQLLIMDQTESDSSMEREDLAKSVLH
FT                   CFSDALSILIDTNDHQDDQSNNSSPQDSSPVLESSRKPLHKRGRKTSMAESSDYHRHES
FT                   STPIYHDGFLWRKYGQKQIKESEYQRSYYKCAYTKDQNCEAKKQVQKIQHNPPLYSTTY
FT                   FGQHICQLHQAYATFPIDTSDFEEHEGSHMIRFGHPNISFSSSTSNLRQHQNHQDRIKD
FT                   EYMKPVIAEDWSPSQWMSSEVALAVEAFEFNPFWTSHDLSS"
     MNSCQQKAME KLLHGHGCAN QLLIMDQTES DSSMEREDLA KSVLHCFSDA LSILIDTNDH        60
     QDDQSNNSSP QDSSPVLESS RKPLHKRGRK TSMAESSDYH RHESSTPIYH DGFLWRKYGQ       120
     KQIKESEYQR SYYKCAYTKD QNCEAKKQVQ KIQHNPPLYS TTYFGQHICQ LHQAYATFPI       180
     DTSDFEEHEG SHMIRFGHPN ISFSSSTSNL RQHQNHQDRI KDEYMKPVIA EDWSPSQWMS       240
     SEVALAVEAF EFNPFWTSHD LSS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page