(data stored in ACNUC6288 zone)

EMBL: CR382138.PE100

CR382138.PE100       Location/Qualifiers
FT   CDS             200078..201295
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02398g"
FT                   /old_locus_tag="IPF_8922"
FT                   /product="DEHA2F02398p"
FT                   /note="weakly similar to uniprot|P42836 Saccharomyces
FT                   cerevisiae YNL326c PFA3 Palmitoyltransferase for Vac8p one
FT                   of three yeast DHHC-cysteine rich domain proteins (Pfa3p
FT                   Erf2p Akr1p) with palmitoyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66258"
FT                   /db_xref="GOA:Q6BMV2"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV2"
FT                   /protein_id="CAR66258.1"
FT                   /translation="MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVYA
FT                   LIVHGCYDTLMTTQETSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRIRN
FT                   ILSLSKPKYNSANPYDTNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLKSNN
FT                   SSYRYCTKCSVWKPDRCHHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMYLTAY
FT                   SGFDFVVSLSILWKFFADEKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYLVFRNK
FT                   TTIEFQENRWNFKNDKNGKSFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPSWYYWLL
FT                   PVTVTNKSIDARLENGINFEIDQDVYDRWCYNAQLQDQLNQQLADYKNRIRMEREANQT
FT                   TDTNPF"
     MLISHPRIMI RHAPWVTSIE TFCCSLATLF PKVFYTSVLT WSVYALIVHG CYDTLMTTQE        60
     TSIFAIAIGL IGLTLYILCL YTYFKVLRAG PGSPSDFEEL RIRNILSLSK PKYNSANPYD       120
     TNDNMATSAS LLANAEGVDE IESIESEQPP SEYMTLHMLK SNNSSYRYCT KCSVWKPDRC       180
     HHCSTCNRCV LRMDHHCPWF AMCVGFYNHK FFAQFLMYLT AYSGFDFVVS LSILWKFFAD       240
     EKYNDHYLSL NLVFLFVLSL AFFITVGGFS AFSLYLVFRN KTTIEFQENR WNFKNDKNGK       300
     SFQYEFDGSG KKKKLGNIFD LGCGRNWRSI MGPSWYYWLL PVTVTNKSID ARLENGINFE       360
     IDQDVYDRWC YNAQLQDQLN QQLADYKNRI RMEREANQTT DTNPF                       405
//

If you have problems or comments...

PBIL Back to PBIL home page