(data stored in ACNUC6288 zone)

EMBL: CR382138.PE106

CR382138.PE106       Location/Qualifiers
FT   CDS             210977..211282
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02530g"
FT                   /old_locus_tag="DEHA0F02816g"
FT                   /old_locus_tag="DEHA-IPF8911"
FT                   /old_locus_tag="DEHA-CDS7318.1"
FT                   /product="DEHA2F02530p"
FT                   /note="similar to uniprot|Q6WNK7 Saccharomyces cerevisiae
FT                   YBR111W-A SUS1 Protein involved in mRNA export coupled
FT                   transcription activation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88781"
FT                   /db_xref="GOA:Q6BMU6"
FT                   /db_xref="InterPro:IPR018783"
FT                   /db_xref="InterPro:IPR038212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMU6"
FT                   /protein_id="CAG88781.2"
FT                   /translation="MTQQQDELDQIKSQIQEHLISSGNYDIINKQLKLQLYESGWFDKV
FT                   TQLANRELQENSAHDTAVSFDQLFSFVKPKAEEMVPSNIKEDVLERLKDYLDDVIQ"
     MTQQQDELDQ IKSQIQEHLI SSGNYDIINK QLKLQLYESG WFDKVTQLAN RELQENSAHD        60
     TAVSFDQLFS FVKPKAEEMV PSNIKEDVLE RLKDYLDDVI Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page