(data stored in ACNUC6288 zone)

EMBL: CR382138.PE110

CR382138.PE110       Location/Qualifiers
FT   CDS             221708..222040
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02618g"
FT                   /old_locus_tag="DEHA0F02937g"
FT                   /old_locus_tag="DEHA-IPF8900"
FT                   /old_locus_tag="DEHA-CDS7040.1"
FT                   /product="DEHA2F02618p"
FT                   /note="highly similar to uniprot|P53173 Saccharomyces
FT                   cerevisiae YGL054C ERV14 Protein localized to COPII-coated
FT                   vesicles involved in vesicle formation and incorporation of
FT                   specific secretory cargo"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88787"
FT                   /db_xref="GOA:Q6BMU1"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU1"
FT                   /protein_id="CAG88787.1"
FT                   /translation="MYSDLECDYINPIELCNKLNPWFIPEGGLHAFITALFLVNGYWFV
FT                   FLLNLPLLAFNVNKFLNKNHLLDATEIFRTLSKHKKESFIKLGFHLLMFFFFLYRMIMA
FT                   LIADDS"
     MYSDLECDYI NPIELCNKLN PWFIPEGGLH AFITALFLVN GYWFVFLLNL PLLAFNVNKF        60
     LNKNHLLDAT EIFRTLSKHK KESFIKLGFH LLMFFFFLYR MIMALIADDS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page