(data stored in ACNUC6288 zone)

EMBL: CR382138.PE112

CR382138.PE112       Location/Qualifiers
FT   CDS             complement(224039..224473)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02662g"
FT                   /old_locus_tag="DEHA0F03003g"
FT                   /old_locus_tag="DEHA-IPF8895"
FT                   /old_locus_tag="DEHA-CDS6217.1"
FT                   /product="DEHA2F02662p"
FT                   /note="similar to p|P48589 uniprot|Q02545 Saccharomyces
FT                   cerevisiae YOR369C RPS12 Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88790"
FT                   /db_xref="GOA:Q6BMT8"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT8"
FT                   /protein_id="CAG88790.1"
FT                   /translation="MSDIEEQPVVEEVAVEQQESGSISIEDALKVVLRTSLVHDGLARG
FT                   LREASKALSRGEAQLCVLCDSVTEESIIKLVEALCNEPEEKIPLIKVSDAKLLGEWAGL
FT                   CQLDREGNARKVVGASCVVVKNWGNDSDERNILLEHFSQQ"
     MSDIEEQPVV EEVAVEQQES GSISIEDALK VVLRTSLVHD GLARGLREAS KALSRGEAQL        60
     CVLCDSVTEE SIIKLVEALC NEPEEKIPLI KVSDAKLLGE WAGLCQLDRE GNARKVVGAS       120
     CVVVKNWGND SDERNILLEH FSQQ                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page