(data stored in ACNUC6288 zone)

EMBL: CR382138.PE113

CR382138.PE113       Location/Qualifiers
FT   CDS             complement(225048..226931)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02684g"
FT                   /old_locus_tag="DEHA0F03025g"
FT                   /old_locus_tag="DEHA-IPF8894"
FT                   /old_locus_tag="DEHA-CDS1482.1"
FT                   /product="DEHA2F02684p"
FT                   /note="similar to uniprot|P32864 Saccharomyces cerevisiae
FT                   YOR370C MRS6 Rab escort protein forms a complex with the
FT                   Ras-like small GTPase Ypt1p that is required for the
FT                   prenylation of Ypt1p by protein geranylgeranyltransferase
FT                   type II (Bet2p-Bet4p) and highly similar to CA5922|CaMRS6
FT                   Candida albicans CaMRS6 geranylgeranyltransferase
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88791"
FT                   /db_xref="GOA:Q6BMT7"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT7"
FT                   /protein_id="CAG88791.2"
FT                   /translation="MSSFNRSERRKSVAERRPSVPYIAPVIPHLAGLEKPQEHSLKMDH
FT                   CDVLIMGTGLVESILAAALSWQGVEILHIDNKQYYGDSTSTLTIDQLKKWCMEVNQGKV
FT                   QHFHDAQFYMPGGKLKDQFHSKDYGIDLTPKIMFAQSDLLSLLIKSRVYKYLEFQSLSN
FT                   FHVFENDNFNKKLSNTTKEDIFTDQSLSLVTKRYLMKFLKFVLQDNNDQNKKSMLQDNA
FT                   NVPIGEFLTKNFNLETPQINELVYSIGLCAKTTTKTPEALTRIKRFLVSFDVYGNFPVM
FT                   VSKYGGPGEISQGFCRSAAVAGTTYKLNTTLVDYDPQSKIARFNDGSNIKINEKVVVSP
FT                   TQMPKFLQQSYNEITEDLKPYNVTRLVTIVKNDCKEWMSEQETSAIVVFPPNSLPTSNQ
FT                   QSVQVIIQNGGSGVCPEGQAVWFSHSSEQDLNKAKQDLECAHEKMESAILRESSNNLDE
FT                   VLDDKDFVLSAQGTPVLVNSIKLGESLQSFVPEEKLEIVCKLGYVQKTFVKPDLSNVIA
FT                   PTPENNVSSATISDAEDIIFSNMPSSEISYDGIIGECKSIFSRITGSDEDFFDVDFEDE
FT                   DDDYNNHQAPSTNSKTTSDSTTTNNIGSPILDSVLDDEGHHEPFGADEMEL"
     MSSFNRSERR KSVAERRPSV PYIAPVIPHL AGLEKPQEHS LKMDHCDVLI MGTGLVESIL        60
     AAALSWQGVE ILHIDNKQYY GDSTSTLTID QLKKWCMEVN QGKVQHFHDA QFYMPGGKLK       120
     DQFHSKDYGI DLTPKIMFAQ SDLLSLLIKS RVYKYLEFQS LSNFHVFEND NFNKKLSNTT       180
     KEDIFTDQSL SLVTKRYLMK FLKFVLQDNN DQNKKSMLQD NANVPIGEFL TKNFNLETPQ       240
     INELVYSIGL CAKTTTKTPE ALTRIKRFLV SFDVYGNFPV MVSKYGGPGE ISQGFCRSAA       300
     VAGTTYKLNT TLVDYDPQSK IARFNDGSNI KINEKVVVSP TQMPKFLQQS YNEITEDLKP       360
     YNVTRLVTIV KNDCKEWMSE QETSAIVVFP PNSLPTSNQQ SVQVIIQNGG SGVCPEGQAV       420
     WFSHSSEQDL NKAKQDLECA HEKMESAILR ESSNNLDEVL DDKDFVLSAQ GTPVLVNSIK       480
     LGESLQSFVP EEKLEIVCKL GYVQKTFVKP DLSNVIAPTP ENNVSSATIS DAEDIIFSNM       540
     PSSEISYDGI IGECKSIFSR ITGSDEDFFD VDFEDEDDDY NNHQAPSTNS KTTSDSTTTN       600
     NIGSPILDSV LDDEGHHEPF GADEMEL                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page