(data stored in ACNUC6288 zone)

EMBL: CR382138.PE117

CR382138.PE117       Location/Qualifiers
FT   CDS             234553..236145
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02772g"
FT                   /old_locus_tag="DEHA0F03113g"
FT                   /old_locus_tag="DEHA-IPF8883"
FT                   /old_locus_tag="DEHA-CDS2114.1"
FT                   /product="DEHA2F02772p"
FT                   /note="weakly similar to uniprot|P12754 Saccharomyces
FT                   cerevisiae YGR083C GCD2 Delta subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88796"
FT                   /db_xref="GOA:Q6BMT5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT5"
FT                   /protein_id="CAG88796.2"
FT                   /translation="MSEQSVSDKTPSAENAVTEASAAVVAGEKELSNKELKELKKKEKA
FT                   AKRAAQKEASGITPEQQDQLAQQKMERKKQQQTATNTNLKKQLNQTLIKDASAKKKIPA
FT                   LFSHLETREQRNASSPSISHIVHPAILSLTLKYSNYKIVGSISRLRNMLETFKIVISDY
FT                   QTPPNTTLTRHLTGHLSHQIEYLKTARPLSVSMGNAIRLLKQEISHISIDTTEQQAKEI
FT                   LNQRIDDLIKEKIDLSDMLIIENASKHVTNGSTILTFGHSHVLENLFKYCVNQQDKKFN
FT                   LIIVDSRPLFEGKNLLTNLVNTNYSPGTEEDDNSDAESATRKIFKSKPITQDHLKVQYV
FT                   LINSLSSTILEDVDCVFLGAHAMLSNGRLFSRVGTGLIAMMCHTRNIPVLAFCESIKFS
FT                   DKVQLDSVTTNELADSGDLIQDIGSKRPPQKKSFALEQFIKQCDEEKAKVTNNLNNKNK
FT                   QQKQKNNNTDEEISGKDANESLLKNWQDIDNLNILNIMYDLTPPEYIKKVVTELGALPP
FT                   SSVPVILREYKSA"
     MSEQSVSDKT PSAENAVTEA SAAVVAGEKE LSNKELKELK KKEKAAKRAA QKEASGITPE        60
     QQDQLAQQKM ERKKQQQTAT NTNLKKQLNQ TLIKDASAKK KIPALFSHLE TREQRNASSP       120
     SISHIVHPAI LSLTLKYSNY KIVGSISRLR NMLETFKIVI SDYQTPPNTT LTRHLTGHLS       180
     HQIEYLKTAR PLSVSMGNAI RLLKQEISHI SIDTTEQQAK EILNQRIDDL IKEKIDLSDM       240
     LIIENASKHV TNGSTILTFG HSHVLENLFK YCVNQQDKKF NLIIVDSRPL FEGKNLLTNL       300
     VNTNYSPGTE EDDNSDAESA TRKIFKSKPI TQDHLKVQYV LINSLSSTIL EDVDCVFLGA       360
     HAMLSNGRLF SRVGTGLIAM MCHTRNIPVL AFCESIKFSD KVQLDSVTTN ELADSGDLIQ       420
     DIGSKRPPQK KSFALEQFIK QCDEEKAKVT NNLNNKNKQQ KQKNNNTDEE ISGKDANESL       480
     LKNWQDIDNL NILNIMYDLT PPEYIKKVVT ELGALPPSSV PVILREYKSA                  530
//

If you have problems or comments...

PBIL Back to PBIL home page