(data stored in ACNUC6288 zone)

EMBL: CR382138.PE120

CR382138.PE120       Location/Qualifiers
FT   CDS             247638..249560
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02838g"
FT                   /old_locus_tag="DEHA0F03234g"
FT                   /old_locus_tag="DEHA-IPF8870"
FT                   /old_locus_tag="DEHA-CDS1412.1"
FT                   /product="DEHA2F02838p"
FT                   /note="weakly similar to uniprot|P38738 Saccharomyces
FT                   cerevisiae YHL029C Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts and similar to
FT                   CA5934|IPF2802 Candida albicans IPF2802 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88802"
FT                   /db_xref="GOA:Q6BMT2"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMT2"
FT                   /protein_id="CAG88802.2"
FT                   /translation="MSQDFINTDNHTSNLSSNNLYTNINAGNSIMSEELAVKDNSNSTV
FT                   ASDNTERTPCDAENGSIYTTGRSVVSDNAGNQDKGKNFPNGESSSASGKSENSHADDEN
FT                   DGSTENNSKLGQPSFSYDSEIFQLCQHYLTTKNHQGLALVARQKGLPPFLRFKIWPILL
FT                   KHHPFVVNPFIEPDNEVNNENDTNTEEDLKSDIKRDLLKYIHRLNYTNLIDLNNASPEE
FT                   QEVFKILESSILKFVKKWGKIMKYDHALTWIALGLAEWFPPIPNTSWVLVGRDFPSSKT
FT                   SCIKNLFHDYSNYINNVPNLNEYLEDLVNDKEIINMSFRDVYERLVLVLLHAPEEKIKN
FT                   KSKDLLGPKKINRKILPINGGTIEERVSFFIYCFRKLLPELSQYFQEEQILNKFGSHDD
FT                   EWLIWWLKWCGSKVWSRLDRGRIWDLIFGWRLQNFKKSNSYYVEKLNLSDNLINKLGPD
FT                   NFWSVSKDNDDSTIENYKKSSSFKDLINELNINESSNSNSPTSNSPSNSSINEDLLPPS
FT                   PLSSSSFSSSNIAPADEFNIPFSKLDPHVELLFVTLALLKSKENTLMELDQHEIRQFLS
FT                   RLPTKSINISNKYKHFKPQESDMNNNIISNDSRNNHKIDFMDNIINESGELWRKWLWSE
FT                   MIDDN"
     MSQDFINTDN HTSNLSSNNL YTNINAGNSI MSEELAVKDN SNSTVASDNT ERTPCDAENG        60
     SIYTTGRSVV SDNAGNQDKG KNFPNGESSS ASGKSENSHA DDENDGSTEN NSKLGQPSFS       120
     YDSEIFQLCQ HYLTTKNHQG LALVARQKGL PPFLRFKIWP ILLKHHPFVV NPFIEPDNEV       180
     NNENDTNTEE DLKSDIKRDL LKYIHRLNYT NLIDLNNASP EEQEVFKILE SSILKFVKKW       240
     GKIMKYDHAL TWIALGLAEW FPPIPNTSWV LVGRDFPSSK TSCIKNLFHD YSNYINNVPN       300
     LNEYLEDLVN DKEIINMSFR DVYERLVLVL LHAPEEKIKN KSKDLLGPKK INRKILPING       360
     GTIEERVSFF IYCFRKLLPE LSQYFQEEQI LNKFGSHDDE WLIWWLKWCG SKVWSRLDRG       420
     RIWDLIFGWR LQNFKKSNSY YVEKLNLSDN LINKLGPDNF WSVSKDNDDS TIENYKKSSS       480
     FKDLINELNI NESSNSNSPT SNSPSNSSIN EDLLPPSPLS SSSFSSSNIA PADEFNIPFS       540
     KLDPHVELLF VTLALLKSKE NTLMELDQHE IRQFLSRLPT KSINISNKYK HFKPQESDMN       600
     NNIISNDSRN NHKIDFMDNI INESGELWRK WLWSEMIDDN                             640
//

If you have problems or comments...

PBIL Back to PBIL home page