(data stored in ACNUC6288 zone)

EMBL: CR382138.PE121

CR382138.PE121       Location/Qualifiers
FT   CDS             250047..251210
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02860g"
FT                   /old_locus_tag="DEHA0F03256g"
FT                   /old_locus_tag="DEHA-IPF8867"
FT                   /old_locus_tag="DEHA-CDS3295.1"
FT                   /product="DEHA2F02860p"
FT                   /note="similar to uniprot|P53883 Saccharomyces cerevisiae
FT                   YNL175c NOP13 Protein of unknown function localizes to the
FT                   nucleolus and nucleoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88803"
FT                   /db_xref="GOA:Q6BMT1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034226"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT1"
FT                   /protein_id="CAG88803.1"
FT                   /translation="MSKEEVEIKKESKKDKKEKKERKKEKKEKKQKKAVDEDSDNENES
FT                   SGDSDDEEIAIDLNAGVPLSKKQKRLLKKGKLNLEKLAKKNPPPKPILTEEEQIKKDAQ
FT                   EPKKSEYGVWIGNLSFDTTKEDITRFIMGKTNAYDADSNDGLVKIEQSDFIRINIPKKE
FT                   NKIKGFAYVDLPSAKHVDTVISLSESHLNGRNLLIKNANSFEGRPQKDTNPLSKNPPSR
FT                   ILFVGNLSFDTTQDLLREHFRHCGDIVKIRMATFEDTGKCKGFAFIDFRDESGPTTALK
FT                   SKLAKSLINRPLRLEYGEDRSKLTPKKFARNRDNFEPSEQDSISQPPPQVSTTRERTKP
FT                   QATPFKRKYDKPENNSNKRQKSSIALATAQRASVAIVPSSGKKTTFD"
     MSKEEVEIKK ESKKDKKEKK ERKKEKKEKK QKKAVDEDSD NENESSGDSD DEEIAIDLNA        60
     GVPLSKKQKR LLKKGKLNLE KLAKKNPPPK PILTEEEQIK KDAQEPKKSE YGVWIGNLSF       120
     DTTKEDITRF IMGKTNAYDA DSNDGLVKIE QSDFIRINIP KKENKIKGFA YVDLPSAKHV       180
     DTVISLSESH LNGRNLLIKN ANSFEGRPQK DTNPLSKNPP SRILFVGNLS FDTTQDLLRE       240
     HFRHCGDIVK IRMATFEDTG KCKGFAFIDF RDESGPTTAL KSKLAKSLIN RPLRLEYGED       300
     RSKLTPKKFA RNRDNFEPSE QDSISQPPPQ VSTTRERTKP QATPFKRKYD KPENNSNKRQ       360
     KSSIALATAQ RASVAIVPSS GKKTTFD                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page