(data stored in ACNUC6288 zone)

EMBL: CR382138.PE122

CR382138.PE122       Location/Qualifiers
FT   CDS             complement(251516..254773)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02882g"
FT                   /old_locus_tag="DEHA0F03278g"
FT                   /old_locus_tag="DEHA-IPF8866"
FT                   /old_locus_tag="DEHA-CDS0334.1"
FT                   /product="DEHA2F02882p"
FT                   /note="weakly similar to uniprot|Q02455 Saccharomyces
FT                   cerevisiae YKR095W MLP1 Myosin-like protein associated with
FT                   the nuclear envelope connects the nuclear pore complex with
FT                   the nuclear interior"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88804"
FT                   /db_xref="InterPro:IPR024527"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT0"
FT                   /protein_id="CAG88804.2"
FT                   /translation="MSEVVEQRASNGDNASTKTSSTQNTRLKKLTSGSEWVSPFRESGH
FT                   SQKNLRQQLKEDNSIKNIHVPSKFTTHPTLDAQKKEKKEKEKAAKLEKKKKEKEAKEKE
FT                   AKEKEAKEKEAKEKEAEDKGDEEETKAVTLKNTEVDPLKAVTLKENGADPKSSKDASMR
FT                   SLKDEPIDTPKESVFGGNKETEDLEYGEDLYEDDVKADNESERPLSEAEQAEVEDEVNG
FT                   DTKKDEPATTDEATKEVSETAVKDKDASGSDEIENVVKEAPIELVTQPGSKYEPVPLPN
FT                   QEVLDKLKDKPKLLSRYQELNAAAVSSLSRSLDDPNKVVDLGSGLRMTQQQLLDIAAKR
FT                   VAPVITNINDEVSKTRNEDEIKRKKELDSKVASHEKKLQKDFDKHNKKLEKQKSKFTTD
FT                   IGNKLQDLKKKMKNSDLTAANFEKETRKEIDTANEDYKERETTAVEKHSKDKDTIIKNH
FT                   EELEGTKKQELEDAKANQETTTQEIEELHERKTELDNANSELSTRIEELTAELNERTIE
FT                   LDDLKAKHAAKQDGISKNLASKDELDNKITTTKKELETKKKQHDKLSAEVGVLGGVLST
FT                   YAAKLTDLKSEASSHGDRLTDAKKKYKDWEDEKDQLATEIAREHERKRATAQEEAETKR
FT                   VEDELEEKRLKNEAERKEAEERVAAKKEEERKLQESHEKAEADRLANDPEHQFMLATQK
FT                   RESDVKKLEDERAEKERVYNEHKDKEAEEAQKLQEEIEELKQQKAAHDESAREEADKLA
FT                   EAKLVQIEQLKKEHEERVKMFKEKLEFEELQKSRLLDEVDNLNKIKELRAEKARLTSEL
FT                   NKDVDVKDVNKLIEERELEVSKLSKQIELDNADLNNFNATQRSALAEGQKSTEPSKDIT
FT                   EADRPSKVSNAPIFANIGGSSKEQNIANKSDHSKPVKNEDNSNSSSQKKSGARATGLAT
FT                   AGLAGAAGAGTAVALDAKNNAKNVSNVNDSKSTGGSFSKLKSLTKRIRGESVSDANAEE
FT                   PAVSSKEKKPSTKSAAPVNISKQPDGKSTKTKAVPVTSSSKRADNAASFSDSSSAYETY
FT                   SVYEEVSEAEYQKNLKNPDYMEMTAEEFEKRRKAGDH"
     MSEVVEQRAS NGDNASTKTS STQNTRLKKL TSGSEWVSPF RESGHSQKNL RQQLKEDNSI        60
     KNIHVPSKFT THPTLDAQKK EKKEKEKAAK LEKKKKEKEA KEKEAKEKEA KEKEAKEKEA       120
     EDKGDEEETK AVTLKNTEVD PLKAVTLKEN GADPKSSKDA SMRSLKDEPI DTPKESVFGG       180
     NKETEDLEYG EDLYEDDVKA DNESERPLSE AEQAEVEDEV NGDTKKDEPA TTDEATKEVS       240
     ETAVKDKDAS GSDEIENVVK EAPIELVTQP GSKYEPVPLP NQEVLDKLKD KPKLLSRYQE       300
     LNAAAVSSLS RSLDDPNKVV DLGSGLRMTQ QQLLDIAAKR VAPVITNIND EVSKTRNEDE       360
     IKRKKELDSK VASHEKKLQK DFDKHNKKLE KQKSKFTTDI GNKLQDLKKK MKNSDLTAAN       420
     FEKETRKEID TANEDYKERE TTAVEKHSKD KDTIIKNHEE LEGTKKQELE DAKANQETTT       480
     QEIEELHERK TELDNANSEL STRIEELTAE LNERTIELDD LKAKHAAKQD GISKNLASKD       540
     ELDNKITTTK KELETKKKQH DKLSAEVGVL GGVLSTYAAK LTDLKSEASS HGDRLTDAKK       600
     KYKDWEDEKD QLATEIAREH ERKRATAQEE AETKRVEDEL EEKRLKNEAE RKEAEERVAA       660
     KKEEERKLQE SHEKAEADRL ANDPEHQFML ATQKRESDVK KLEDERAEKE RVYNEHKDKE       720
     AEEAQKLQEE IEELKQQKAA HDESAREEAD KLAEAKLVQI EQLKKEHEER VKMFKEKLEF       780
     EELQKSRLLD EVDNLNKIKE LRAEKARLTS ELNKDVDVKD VNKLIEEREL EVSKLSKQIE       840
     LDNADLNNFN ATQRSALAEG QKSTEPSKDI TEADRPSKVS NAPIFANIGG SSKEQNIANK       900
     SDHSKPVKNE DNSNSSSQKK SGARATGLAT AGLAGAAGAG TAVALDAKNN AKNVSNVNDS       960
     KSTGGSFSKL KSLTKRIRGE SVSDANAEEP AVSSKEKKPS TKSAAPVNIS KQPDGKSTKT      1020
     KAVPVTSSSK RADNAASFSD SSSAYETYSV YEEVSEAEYQ KNLKNPDYME MTAEEFEKRR      1080
     KAGDH                                                                  1085
//

If you have problems or comments...

PBIL Back to PBIL home page